BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0217 (733 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC027994-1|AAH27994.1| 605|Homo sapiens beta-transducin repeat ... 30 9.8 AL627424-17|CAI41042.1| 605|Homo sapiens beta-transducin repeat... 30 9.8 AL445463-2|CAI12963.1| 605|Homo sapiens beta-transducin repeat ... 30 9.8 AL445463-1|CAI12962.1| 191|Homo sapiens beta-transducin repeat ... 30 9.8 AL133387-1|CAH70020.1| 605|Homo sapiens beta-transducin repeat ... 30 9.8 AF101784-1|AAD08702.1| 605|Homo sapiens b-TRCP variant E3RS-Ika... 30 9.8 >BC027994-1|AAH27994.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 9.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 285 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 428 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AL627424-17|CAI41042.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 9.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 285 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 428 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AL445463-2|CAI12963.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 9.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 285 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 428 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AL445463-1|CAI12962.1| 191|Homo sapiens beta-transducin repeat containing protein. Length = 191 Score = 29.9 bits (64), Expect = 9.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 285 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 428 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 2 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 50 >AL133387-1|CAH70020.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 9.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 285 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 428 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AF101784-1|AAD08702.1| 605|Homo sapiens b-TRCP variant E3RS-IkappaB protein. Length = 605 Score = 29.9 bits (64), Expect = 9.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 285 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 428 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,945,956 Number of Sequences: 237096 Number of extensions: 2410331 Number of successful extensions: 4380 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4377 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -