BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0215 (803 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 23 3.8 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 3.8 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 186 RQ*AVTLQSWLCSTGENPHPS 124 R+ TL++WL +NP+P+ Sbjct: 93 RESTATLKAWLNEHKKNPYPT 113 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.6 bits (46), Expect = 3.8 Identities = 17/75 (22%), Positives = 32/75 (42%) Frame = +1 Query: 400 CHGQLSCRSSQRKLYLTQNTTQQSRSSCVAHDGRESADSTYEMVGGLDKQIKEIKEVIEL 579 CH LSC+S+ + Y T T + C + + G+ + ++ + + Sbjct: 140 CHRVLSCKSALQMHYRTH--TGERPFKCKICGRAFTTKGNLKTHMGVHRAKPPMRVLHQC 197 Query: 580 PVKHPELFDALGIAQ 624 PV H + +AL + Q Sbjct: 198 PVCHKKFTNALVLQQ 212 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,746 Number of Sequences: 336 Number of extensions: 3997 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -