BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0206 (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0393 + 13435581-13435745,13435804-13436418,13437283-134373... 28 6.0 02_01_0579 - 4293528-4294117,4294561-4294762,4296145-4296348,429... 28 6.0 >05_03_0393 + 13435581-13435745,13435804-13436418,13437283-13437349, 13437605-13438239 Length = 493 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 273 RAIFLNINKSKKLNC-PLHTHKLDCARERDGQIFMMRMQ-CDVTP 401 RA LN+N K++C PL + ++ C ++ G+ F++ C+ P Sbjct: 15 RASALNVNNQSKMDCFPLASREVICT-DQSGRAFLVNADTCEFVP 58 >02_01_0579 - 4293528-4294117,4294561-4294762,4296145-4296348, 4296425-4296585,4296665-4297158,4297526-4297584, 4297766-4297841,4298511-4298552,4298757-4298860, 4299071-4299280 Length = 713 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 413 TNTTQAQRVNVSNASYMVDRVGVLGFIFVTEFLIRSLHSKP 535 TNT ++ +A+ R + GF+ VTE L+ LH KP Sbjct: 12 TNTRPGFTTSLGSATGENLRSELRGFVCVTELLLMDLHVKP 52 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,985,571 Number of Sequences: 37544 Number of extensions: 263725 Number of successful extensions: 451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -