BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0203 (767 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharom... 25 9.0 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 25 9.0 >SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 25.4 bits (53), Expect = 9.0 Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 605 YFF-LSLNPSLFGLRCNLQFGKLLAWVWQFW 516 YF + L P++ + G ++W W+FW Sbjct: 169 YFLGICLGPAIAPIASGFIAGSSISWRWEFW 199 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 25.4 bits (53), Expect = 9.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 583 PVFLGFGAIFNLENCWLGFGSFG 515 P F GFG+ N N G G FG Sbjct: 333 PAFSGFGSTTNTTNTGTGTGLFG 355 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,416,619 Number of Sequences: 5004 Number of extensions: 19226 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -