BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0202 (827 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g04780.1 68416.m00515 expressed protein 62 6e-10 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 56 4e-08 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 55 5e-08 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 55 7e-08 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 55 7e-08 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 52 4e-07 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 52 4e-07 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 51 8e-07 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 48 8e-06 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 47 2e-05 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 46 2e-05 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 46 4e-05 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 45 7e-05 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 44 9e-05 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 43 3e-04 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 43 3e-04 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 42 4e-04 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 40 0.002 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 40 0.002 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 40 0.003 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 38 0.011 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 38 0.011 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 38 0.011 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 38 0.011 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 37 0.014 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 37 0.014 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 37 0.014 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 37 0.019 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 36 0.025 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 36 0.025 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 36 0.043 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 36 0.043 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 36 0.043 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 35 0.057 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 35 0.057 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 35 0.076 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 34 0.10 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 34 0.10 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 34 0.13 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 33 0.18 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 33 0.23 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 33 0.31 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 33 0.31 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 33 0.31 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 32 0.40 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 32 0.53 At5g40370.1 68418.m04897 glutaredoxin, putative similar to gluta... 31 0.71 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 31 0.71 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 31 0.93 At3g03860.1 68416.m00398 expressed protein 30 1.6 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 30 2.2 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 29 3.8 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 29 3.8 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 29 5.0 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 29 5.0 >At3g04780.1 68416.m00515 expressed protein Length = 176 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 5/66 (7%) Frame = +3 Query: 507 NEADDHPLAQALTN----DRGY-LASYCDEQLIINISFNQLVKLHSIKIKGPADKGPKSI 671 N++ H L AL D G L S DEQL+I I FNQ++KLHS IKGP ++GPK++ Sbjct: 29 NQSSSHSLPNALKQGYREDEGLNLESDADEQLLIYIPFNQVIKLHSFAIKGPEEEGPKTV 88 Query: 672 KLFINQ 689 K F N+ Sbjct: 89 KFFSNK 94 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = +2 Query: 134 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 Q + AN LVVVDFTA+WC PC+ IAPFF L K P F K Sbjct: 20 QLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLK 64 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/65 (32%), Positives = 34/65 (52%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 PFF K+ +FLKVD D AS + AMPTF+F + +D++ G L++ Sbjct: 48 PFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQS 107 Query: 397 KVRQY 411 + ++ Sbjct: 108 TIAKH 112 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 55.2 bits (127), Expect = 5e-08 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = +2 Query: 146 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 AN KL+V+DFTA+WCPPC+ IAP F ++ KF F K Sbjct: 23 ANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFK 63 Score = 45.2 bits (102), Expect = 5e-05 Identities = 23/67 (34%), Positives = 32/67 (47%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P F K + VF K+DVD A V AMPTF+F + IDR+ G + Sbjct: 47 PVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINE 106 Query: 397 KVRQYYG 417 K+ ++ G Sbjct: 107 KLMKHGG 113 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/68 (35%), Positives = 42/68 (61%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P + ++ S VFLKVD+D+ D A++ +S++PTF F R+ ++D++ G + LE Sbjct: 312 PLYSNLATQHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQ 371 Query: 397 KVRQYYGS 420 K+ Q+ S Sbjct: 372 KIAQHSSS 379 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +2 Query: 134 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 +T+ A ++L+++ FTATWC PC+ ++P + L + R F K Sbjct: 284 KTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLK 328 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 54.8 bits (126), Expect = 7e-08 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 134 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 247 Q + A KL+V+DFTA+WCPPC+ IAP F L KF Sbjct: 20 QLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKF 57 Score = 51.2 bits (117), Expect = 8e-07 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +1 Query: 217 PFFRAATSK-VSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLE 393 P F K +S +F KVDVD A GV AMPTF+F + +D+L G N L+ Sbjct: 48 PIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQ 107 Query: 394 NKVRQYYGSDVA 429 K+ ++ G A Sbjct: 108 AKIVKHTGVTTA 119 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = +2 Query: 146 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAK 244 AN KL+V+DFTATWCPPC+ IAP F L K Sbjct: 23 ANESKKLIVIDFTATWCPPCRFIAPVFADLAKK 55 Score = 35.5 bits (78), Expect = 0.043 Identities = 19/42 (45%), Positives = 21/42 (50%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYR 342 P F K + VF KVDVD A V AMPTFIF + Sbjct: 47 PVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMK 88 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 52.4 bits (120), Expect = 4e-07 Identities = 26/62 (41%), Positives = 36/62 (58%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 PFF + K S +FL VDVD +D +S+ + A PTF F +N +I +L G N L+ Sbjct: 65 PFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQIGKLVGANKPELQK 124 Query: 397 KV 402 KV Sbjct: 125 KV 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +2 Query: 146 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAK 244 A+ K+VV +F+ATWC PC+ +APFF +L K Sbjct: 41 ADRDGKIVVANFSATWCGPCKIVAPFFIELSEK 73 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 51.2 bits (117), Expect = 8e-07 Identities = 25/65 (38%), Positives = 33/65 (50%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P R SK SE VF +VDVDR D A +P F+F + +IDR+ G L Sbjct: 63 PRVREIASKYSEAVFARVDVDRLMDVAGTYRAITLPAFVFVKRGEEIDRVVGAKPDELVK 122 Query: 397 KVRQY 411 K+ Q+ Sbjct: 123 KIEQH 127 Score = 41.5 bits (93), Expect = 7e-04 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 KL+V+DFTA WC PC+ + P ++ +K+ F++ Sbjct: 44 KLLVIDFTAVWCGPCKAMEPRVREIASKYSEAVFAR 79 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 48.0 bits (109), Expect = 8e-06 Identities = 22/67 (32%), Positives = 36/67 (53%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 PF + ++ FLKVD+D+C +A+ V +PT Y+N +++ + + VLE Sbjct: 633 PFVDSLCTRYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRVKEIVCPSKEVLEY 692 Query: 397 KVRQYYG 417 VR Y G Sbjct: 693 SVRHYSG 699 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P A K ++ F+K+DVD D A V+AMPTF+ + +I+R+ G LE Sbjct: 67 PAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEK 126 Query: 397 KV 402 KV Sbjct: 127 KV 128 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAPFFEQLPAKF 247 KL+VVDF+A+WC PC+ I P + KF Sbjct: 48 KLLVVDFSASWCGPCRMIEPAIHAMADKF 76 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/61 (36%), Positives = 33/61 (54%) Frame = +1 Query: 220 FFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENK 399 FF + +FL VDVD + AS V AMPTF+F ++ +D+L G N ++ + Sbjct: 45 FFEELAFNYKDALFLIVDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKR 104 Query: 400 V 402 V Sbjct: 105 V 105 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQLPAKFPREYF 262 +V FTA WC P + FFE+L + F Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALF 58 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/61 (32%), Positives = 35/61 (57%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P FR S+ +F+ VDV+ A+ ++ V A PT +F ++ ++D+L G T+ L+ Sbjct: 28 PVFRDLASRYPSMIFVTVDVEELAEFSNEWNVEATPTVVFLKDGRQMDKLVGAETSELQK 87 Query: 397 K 399 K Sbjct: 88 K 88 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 146 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYF 262 AN G K + A WC PC++I P F L +++P F Sbjct: 6 ANTGPKERSI--RAPWCVPCKKIEPVFRDLASRYPSMIF 42 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 44.8 bits (101), Expect = 7e-05 Identities = 22/59 (37%), Positives = 32/59 (54%) Frame = +2 Query: 92 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 T+G T + D + A AG K+VV+D WC PC+ IAP +++L K+ F K Sbjct: 76 TVGQVTEVDKDTFWPIVKA-AGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLK 133 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/59 (32%), Positives = 35/59 (59%) Frame = +1 Query: 259 FLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEE 435 F +V+ + + + A V+A+P F+F+++ +D LEG + + L NKV + GS + E Sbjct: 55 FFRVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGSSTSAE 113 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQLPAKFPREYF 262 VV+ F A+WC +++ F L FPR +F Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHF 55 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/59 (37%), Positives = 31/59 (52%) Frame = +2 Query: 92 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 ++G T + D + A AG KLVV+D WC PC+ IAP ++ L K+ F K Sbjct: 66 SVGQVTEVDKDTFWPIVKA-AGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLK 123 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 KL+V++FTA WC PC+ + P E+L AK+ F K Sbjct: 60 KLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVK 95 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P +K ++ F+K+DVD +S +P +F + ++D + G LE Sbjct: 79 PKLEELAAKYTDVEFVKIDVDVLMSVWMEFNLSTLPAIVFMKRGREVDMVVGVKVDELER 138 Query: 397 KVRQY 411 K+ +Y Sbjct: 139 KLNKY 143 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/61 (27%), Positives = 34/61 (55%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P ++ S + +F+ +DV+ A+ + V A PT +F ++ ++D+L GG+ L+ Sbjct: 82 PIYQELASTYTSMIFVTIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGDAAELQK 141 Query: 397 K 399 K Sbjct: 142 K 142 Score = 36.7 bits (81), Expect = 0.019 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +2 Query: 146 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYF 262 AN+ K++VV+F A+WC P + I P +++L + + F Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELASTYTSMIF 96 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/54 (31%), Positives = 32/54 (59%) Frame = +1 Query: 259 FLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGS 420 F +V+ + + + A V+ +P F+F+++ +D LEG + + L NKV + GS Sbjct: 55 FFRVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGS 108 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQLPAKFPREYF 262 +V+ F A+WC +++ F L FPR +F Sbjct: 24 LVLHFWASWCDASKQMDQVFSHLATDFPRAHF 55 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLEN 396 P FR ++ S+ F+ D+D C +T + + PTF FYR+ K+D + G L + Sbjct: 63 PAFRKLSNSFSKLKFVYADIDECPETT--RHIRYTPTFQFYRDGEKVDEMFGAGEQRLHD 120 Query: 397 KV 402 ++ Sbjct: 121 RL 122 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +2 Query: 110 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP 250 V++++A F + ++ A G+ V FTA WC PC+ I+P +L K+P Sbjct: 53 VLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYP 101 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +1 Query: 217 PFFRAATSKVSERVFLKVDVDR--CADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVL 390 P ++K + KVD+D ++ VSA+PT F++ K + G + L Sbjct: 91 PVILELSNKYPDVTTYKVDIDEGGLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDVVRL 150 Query: 391 ENKVRQYY 414 ++ + Q Y Sbjct: 151 KSVMEQLY 158 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 113 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 I + F + ++ AG +LV+V+F TWC C+ + P + + P F K Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLK 159 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 113 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 I + F + ++ AG +LV+V+F TWC C+ + P + + P F K Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLK 159 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +2 Query: 119 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREY 259 +D+ +QT++ + V+V+F A WC PC+ I P +QL F ++ Sbjct: 92 SDSEWQTKVLESDVP-VLVEFWAPWCGPCRMIHPIVDQLAKDFAGKF 137 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 37.5 bits (83), Expect = 0.011 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 119 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 247 N +F + + + K VV+F A WCP C+ P +E++ F Sbjct: 41 NTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARLF 83 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 113 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 I + F + +AG +LV+VDF TWC C+ + P + + P F K Sbjct: 98 ITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLK 149 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 110 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR 253 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F + Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKK 71 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRE 256 K V+V+F A WC C+ +AP +E++ F +E Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQE 191 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 110 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR 253 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F + Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKK 71 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRE 256 K V+V+F A WC C+ +AP +E++ F +E Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQE 191 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +2 Query: 137 TEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREY 259 TE+ N+ T V+V FTA WC PC+ + P ++ +++ E+ Sbjct: 221 TEL-NSQTPHVMVMFTARWCGPCRDMIPILNKMDSEYKNEF 260 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = +2 Query: 113 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYFSK 268 IQ+ H + NAG +LVV+DF + C C+ + P QL P F K Sbjct: 90 IQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLAETNPNVMFLK 141 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +1 Query: 259 FLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 411 FLKV++ +C + +A+ V +PTF Y+ ++ + + LE VR Y Sbjct: 669 FLKVEIVKCPEVGNAERVRVVPTFKIYKLGIRMKEIVCPSKEALEKTVRHY 719 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 35.5 bits (78), Expect = 0.043 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAPFFEQL 235 K V+VDF ATWC PCQ + P ++ Sbjct: 77 KPVLVDFYATWCGPCQLMVPILNEV 101 Score = 31.1 bits (67), Expect = 0.93 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 262 LKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEG 372 +K+D ++ A+ + A+PTFI +++ DR EG Sbjct: 112 VKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEG 148 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 35.5 bits (78), Expect = 0.043 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 119 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 247 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 35.5 bits (78), Expect = 0.043 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 119 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 247 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +2 Query: 110 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP 250 +++++ F M+ A G+ V FTA WC PC+ I+P +L ++P Sbjct: 88 LVKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYP 136 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 113 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREY 259 + ND+ + + + A V VDF A WC PC+ I P +L K+ ++ Sbjct: 78 VVNDSTWDSLVLKADEP-VFVDFWAPWCGPCKMIDPIVNELAQKYAGQF 125 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 34.7 bits (76), Expect = 0.076 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQLPAKF 247 V+V+F ATWC PC+ I P E L ++ Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEY 116 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 113 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQL 235 + ND+ + + + A T VVVDF A WC PC+ I P L Sbjct: 84 VVNDSTWDSLVLKA-TGPVVVDFWAPWCGPCKMIDPLVNDL 123 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 34.3 bits (75), Expect = 0.10 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 131 FQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQL 235 F+ + N+ K V+VD+ ATWC PCQ + P ++ Sbjct: 73 FEDLLVNSD-KPVLVDYYATWCGPCQFMVPILNEV 106 Score = 34.3 bits (75), Expect = 0.10 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = +1 Query: 214 CPFFRAATSKVSERV-----FLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGN 378 C F ++VSE + +K+D ++ A+ + A+PTFI +++ DR EG Sbjct: 96 CQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGAL 155 Query: 379 T 381 T Sbjct: 156 T 156 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 33.9 bits (74), Expect = 0.13 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRE 256 K V+++F A WC CQ++AP +++ F + Sbjct: 391 KNVLIEFYAPWCGHCQKLAPILDEVALSFQND 422 Score = 32.7 bits (71), Expect = 0.31 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQ 232 +VV+F A WC CQ++AP +E+ Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEK 70 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 259 FLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 411 F KVDV+ A A+ + +PTF Y+ K+ + + +LE+ V + Sbjct: 630 FFKVDVEESLALAKAESIKKIPTFKIYKKGEKVKEMVCPSHQLLEDSVTHF 680 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 259 FLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 411 F VDV+ A A+ + +PTF Y+N K+ + + LE+ ++ + Sbjct: 639 FFMVDVEESMALAKAESIRKVPTFKMYKNGDKVKEMVCPSHQFLEDSIKHF 689 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 32.7 bits (71), Expect = 0.31 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 149 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 247 N+G K V+++F A WC CQ++AP +++ + Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSY 421 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQ 232 +VV+F A WC C+++AP +E+ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEK 71 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 32.7 bits (71), Expect = 0.31 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 149 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 247 N+G K V+++F A WC CQ++AP +++ + Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSY 421 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQ 232 +VV+F A WC C+++AP +E+ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEK 71 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 104 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 220 A+V N ++F E+ +L +V+F A WC C+++AP Sbjct: 164 ASVELNSSNFD-ELVTESKELWIVEFFAPWCGHCKKLAP 201 Score = 31.5 bits (68), Expect = 0.71 Identities = 12/37 (32%), Positives = 26/37 (70%) Frame = +2 Query: 125 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQL 235 ++F++++ N+ +V+V+F A WC CQ + P +E++ Sbjct: 36 SNFKSKVLNSNG-VVLVEFFAPWCGHCQSLTPTWEKV 71 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 143 MANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPREYF 262 + NAG KLVVVDF + C C+ + P ++ K P F Sbjct: 108 LRNAGDKLVVVDFFSPSCGGCKALHPKICKIAEKNPEVEF 147 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 31.9 bits (69), Expect = 0.53 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 167 VVVDFTATWCPPCQRIAPFFEQLPAKF 247 ++VDF ATWC PC +A E L ++ Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVEY 123 >At5g40370.1 68418.m04897 glutaredoxin, putative similar to glutaredoxin [Ricinus communis] SWISS-PROT:P55143 Length = 111 Score = 31.5 bits (68), Expect = 0.71 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 170 VVDFTATWCPPCQRIAPFFEQLPAKF 247 VV F+ T+CP C R+ +QL AKF Sbjct: 15 VVVFSKTYCPYCVRVKELLQQLGAKF 40 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 31.5 bits (68), Expect = 0.71 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 110 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 220 +++ND Q ++ + K + + F+A WC PCQR P Sbjct: 28 LVRNDGE-QVKVDSLLGKKIGLYFSAAWCGPCQRFTP 63 Score = 30.3 bits (65), Expect = 1.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 161 KLVVVDFTATWCPPCQRIAP 220 K +++ F+A WCPPC+ P Sbjct: 364 KTILMYFSAHWCPPCRAFTP 383 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 143 MANAGTKLVVVDFTATWCPPCQRIAP 220 + NAG KLVVVDF + C C+ + P Sbjct: 112 LTNAGDKLVVVDFFSPGCGGCKALHP 137 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 155 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR 253 G + V F A+WCP + + P F+ L + FP+ Sbjct: 73 GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQ 105 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/37 (29%), Positives = 26/37 (70%) Frame = +2 Query: 125 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQL 235 ++F++++ N+ +V+V+F A WC C+ + P +E++ Sbjct: 38 SNFKSKVLNSNG-VVLVEFFAPWCGHCKALTPTWEKV 73 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 104 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 220 A+V N ++F ++ +L +V+F A WC C+++AP Sbjct: 163 ASVELNASNFD-DLVIESNELWIVEFFAPWCGHCKKLAP 200 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 140 EMANAGTKLVVVDFTATWCPPCQRIAP 220 E A + K VV+F A WC C+ +AP Sbjct: 132 EEALSNGKPTVVEFYADWCEVCRELAP 158 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/66 (22%), Positives = 31/66 (46%) Frame = +1 Query: 256 VFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEE 435 V K++ D+ + A + A PT + Y + ++ +L ++++ DVA Sbjct: 86 VIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVAVL 145 Query: 436 DEDNTV 453 + D+TV Sbjct: 146 ESDSTV 151 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 110 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 220 V+ + +F + N + V+V+F A WC CQ +AP Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAP 140 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 110 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 220 V+ + +F + N + V+V+F A WC CQ +AP Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAP 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,336,638 Number of Sequences: 28952 Number of extensions: 309797 Number of successful extensions: 992 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -