BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0201 (809 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 1.1 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 1.9 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 3.3 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 22 5.8 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 449 KKTGPPAVEVTSAEQAKELIMPILLLYLVSFRTRAQP 559 K P V + E + L+ ILL YLV+F +P Sbjct: 680 KHNDTPVVRASGRELSYVLLSGILLCYLVTFALVLRP 716 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect = 1.9 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -2 Query: 469 SRGASLLLQPTDDVISLTTT*IVDRTAIPEEFESRVSSYTVALGEILFLSC 317 ++G L P + LTT ++ + IP+E S YT + +I C Sbjct: 270 AKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDC 320 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.0 bits (47), Expect = 3.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 789 SARIQRLVGCSGQH 748 SAR QR+ GC+G H Sbjct: 396 SARHQRIGGCNGLH 409 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 81 LKHAFRYYRHLFASLLRRRNSVKCRK 4 LKH + R AS++ R+ +V C K Sbjct: 165 LKHPWICQRERVASVVHRQETVDCLK 190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,308 Number of Sequences: 438 Number of extensions: 3650 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -