BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0200 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 22 2.8 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 8.6 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 22.2 bits (45), Expect = 2.8 Identities = 15/70 (21%), Positives = 31/70 (44%) Frame = +2 Query: 305 GDSYLSELIRIKIYGLNSNKESKHVQCVLKSIPKNVSRRLTFRSNEFFYNEISFYEKVLP 484 G+ ++ +++ L +N KH +L S+ K R R+N+ S + + Sbjct: 64 GEQWMQKVVSFHKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVF 123 Query: 485 ELSKFRASKA 514 + ++F A A Sbjct: 124 KETEFIAVTA 133 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 326 LIRIKIYGLNSNKESKHVQCVLKSIPKNV 412 L+ + YG N+ESK +L +P+ V Sbjct: 332 LVSVCFYGSWINEESKLSLDLLSYVPREV 360 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,513 Number of Sequences: 336 Number of extensions: 1843 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -