BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0200 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81460-2|CAB03831.1| 439|Caenorhabditis elegans Hypothetical pr... 28 4.6 Z81138-2|CAB03473.1| 2265|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z81460-2|CAB03831.1| 439|Caenorhabditis elegans Hypothetical protein C04A11.2 protein. Length = 439 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 316 PQRVDSHQNLRPEFKQRVEARPVRIKEHPKKR 411 P R+ +N RPEF +RVEAR I+ +KR Sbjct: 315 PPRIHLERN-RPEFIERVEARQSIIRAASEKR 345 >Z81138-2|CAB03473.1| 2265|Caenorhabditis elegans Hypothetical protein W05B2.4 protein. Length = 2265 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 171 MADDFKTLTGVSPLITNERL 230 + DD+K L GVSP +T E L Sbjct: 360 LIDDYKVLWGVSPKLTEEEL 379 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,782,047 Number of Sequences: 27780 Number of extensions: 177576 Number of successful extensions: 545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -