Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0195
         (648 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y18563-1|CAB96131.1|  629|Homo sapiens Nuraminidase protein.           31   2.7  

>Y18563-1|CAB96131.1|  629|Homo sapiens Nuraminidase protein.
          Length = 629

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +2

Query: 74  MKILAFVCL-LKLAMCIALPAEQSGAQLGTTVPVPHDIPQAPGKPEENATAVQPTK 238
           +++L   C  L + +C++LP+  +GA  G     P D+P  P   E  A++  PT+
Sbjct: 137 LRVLRLSCFSLSILLCLSLPSLGAGASSGLRRMRPADLPPRP-MEESPASSSAPTE 191


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,101,628
Number of Sequences: 237096
Number of extensions: 1427439
Number of successful extensions: 3509
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3356
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3509
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7197658880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)