BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0192 (437 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0909 + 22512313-22512474,22513151-22513465,22513539-225166... 29 1.6 01_01_0242 + 1997427-1997429,1997893-1998580,2000199-2000234,200... 27 8.7 >07_03_0909 + 22512313-22512474,22513151-22513465,22513539-22516633, 22516812-22516910,22517031-22517379 Length = 1339 Score = 29.1 bits (62), Expect = 1.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 Query: 172 SETECPLFVEYERNGITRGNY 234 +E +CPL V YE+NG+ R ++ Sbjct: 240 TEGKCPLIVFYEKNGLERSHF 260 >01_01_0242 + 1997427-1997429,1997893-1998580,2000199-2000234, 2000786-2001114,2001178-2001855 Length = 577 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 296 RPHILNPGCFKSMPNVIGIGTKLFRGKMLSGLL 394 RP +L PGC S+ V+G+ + M GLL Sbjct: 152 RPRLLLPGCSMSVVPVLGLQDGDYVASMRRGLL 184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,472,357 Number of Sequences: 37544 Number of extensions: 215818 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -