BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0192 (437 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003388-3|AAB54268.1| 220|Caenorhabditis elegans Hypothetical ... 31 0.37 U80029-9|AAB37588.1| 459|Caenorhabditis elegans Hypothetical pr... 27 7.9 >AF003388-3|AAB54268.1| 220|Caenorhabditis elegans Hypothetical protein R10F2.5 protein. Length = 220 Score = 31.1 bits (67), Expect = 0.37 Identities = 16/58 (27%), Positives = 24/58 (41%) Frame = -3 Query: 186 ALRFRAATHRVTCFDYRIEINRRRSEDLDLIFSLAP*VTLGHFATKTLPPTLQGHDWP 13 AL + D R+ + + R ED + + + LG A KTL +GH P Sbjct: 8 ALYLNLGVEMMYVLDQRLRVQKERVEDREKSDKVVKEIMLGFLAKKTLDEVFKGHGTP 65 >U80029-9|AAB37588.1| 459|Caenorhabditis elegans Hypothetical protein T20D4.9 protein. Length = 459 Score = 26.6 bits (56), Expect = 7.9 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 304 MRPLASASRTICTYSRLRPN-NFGNN 230 M P AS S T YSR+ PN +F NN Sbjct: 17 MTPEASLSLTSQVYSRINPNISFSNN 42 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,583,308 Number of Sequences: 27780 Number of extensions: 179138 Number of successful extensions: 321 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 321 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 745968860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -