BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0186 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0190 + 15607241-15607409,15607932-15607990,15608883-156089... 29 4.9 >10_08_0190 + 15607241-15607409,15607932-15607990,15608883-15608991, 15609394-15609551,15609976-15610044,15610158-15610847, 15611112-15611629,15611725-15611789,15613010-15613089, 15613894-15613998,15614768-15614881,15615029-15615168, 15615257-15615385,15615903-15616055,15616186-15616327 Length = 899 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 413 SCFRVNGDVSGINNNEKGVNWGWE*VELQRL 505 +CF + V+G N + G N WE LQR+ Sbjct: 390 TCFSLEWQVTGCLNGKAGTNCSWEAYVLQRV 420 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,634,830 Number of Sequences: 37544 Number of extensions: 352578 Number of successful extensions: 521 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -