BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0186 (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.2 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.9 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 23 3.9 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 5.1 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 8.9 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 8.9 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 8.9 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 453 LFIPETSPFTLKQLIFTCISNYQKTFKPITTETYLLYIYDG 331 L I E +P T K+L +SNY + +P+ T L + G Sbjct: 25 LKIFEANPDT-KRLYDDLLSNYNRLIRPVMNNTETLTVQLG 64 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 615 FSLSNFFCLEFFYQMMK*NSTYLIHIH 535 +S NF CLE + + + YL H + Sbjct: 226 YSTGNFTCLEVVFVLKRRLGYYLFHTY 252 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 44 QPIQRACVFYEIKSKSFDEKMINWRRLAAIT 136 Q Q C +SF E MIN R A T Sbjct: 73 QLFQTPCELLNFPKRSFSENMINDHRQPAPT 103 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/29 (24%), Positives = 16/29 (55%) Frame = -3 Query: 621 IKFSLSNFFCLEFFYQMMK*NSTYLIHIH 535 I++S NF C++ + + + +L H + Sbjct: 193 IEYSTGNFTCIQIVFNLRRRLGYHLFHTY 221 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.9 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 513 IGTCLFNYVYELGKYYFISSFDKKIPNRRN*IVKIL-LLKSSSAHP 647 +GTC L +Y + K+I R+N KI +K++ +P Sbjct: 287 LGTCFVMVFASLLEYATVGYMAKRIQMRKNRFQKIAESMKTARENP 332 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.9 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 513 IGTCLFNYVYELGKYYFISSFDKKIPNRRN*IVKIL-LLKSSSAHP 647 +GTC L +Y + K+I R+N KI +K++ +P Sbjct: 287 LGTCFVMVFASLLEYATVGYMAKRIQMRKNRFQKIAESMKTARENP 332 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.4 bits (43), Expect = 8.9 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 513 IGTCLFNYVYELGKYYFISSFDKKIPNRRN*IVKIL-LLKSSSAHP 647 +GTC L +Y + K+I R+N KI +K++ +P Sbjct: 226 LGTCFVMVFASLLEYATVGYMAKRIQMRKNRFQKIAESMKTARENP 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,340 Number of Sequences: 438 Number of extensions: 4745 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -