BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0184 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 31 0.93 SB_48623| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 31.1 bits (67), Expect = 0.93 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +3 Query: 30 GWCCKPTNKSRH---RGSCETRRR*HSCDXQLRGHDSNSRWNAGWPTSKNTCI*DIDSKI 200 GW K TNK+ + R + T H C LR +D N AG+ TS TCI D S + Sbjct: 802 GWG-KTTNKTVYTDLRQANVTLVHRHRCSWALRNYDGNRLLCAGFLTSDVTCISDSGSPL 860 >SB_48623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 369 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +2 Query: 311 CASK*YTAICYPCEDLNGHDCSNYAKSSNDEQVWSSRFSSTKHHSGGHYCKVS 469 C+S T + YPC + ++ D W+SRF+S K H +Y S Sbjct: 58 CSSATMTTVYYPC-----------SSATMDSSAWNSRFASVKLHRQKNYMATS 99 >SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 3 KNSRRNALTGWCCKPTNKSR 62 K RR+A W CKPT+K R Sbjct: 140 KAIRRDARINWICKPTHKHR 159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,057,777 Number of Sequences: 59808 Number of extensions: 401039 Number of successful extensions: 1007 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -