BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0180 (639 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 24 1.2 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 24 1.2 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 5.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.6 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 492 LITYRAPQTRSWEKRRISPRARPQAGE*RHQQHP 593 L P EK I+PR RP+A + + + P Sbjct: 296 LAAQEIPGQNPGEKTNIAPRERPRATDHQRRNEP 329 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = -3 Query: 433 RVLAFFSRSIEEXFAKPGRFTVSIEK*APMAKYWIDAATSSWICFLIML 287 RVL + + F+ P F ++ M + WID T W ++ ++ Sbjct: 162 RVLVMLAWLLSILFSLPTVFLFEEKQVQSMPQCWIDLQTWQWKVYITLV 210 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 475 RLRKPTSSRTGPRKHG 522 +L++P S+ PRKHG Sbjct: 97 KLQEPQPSQHCPRKHG 112 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = +3 Query: 249 HQDEWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVN 377 H D E CY +K+ ++E I+ S+D N Sbjct: 217 HPDSGNMFENGCYLRRQKRFKDEKKELIRQTHKSPSHSVDNSN 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,434 Number of Sequences: 336 Number of extensions: 2607 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -