BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0180 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 4.7 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 8.2 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 278 DLLQHDEETDPGGSGRVNPVLS 343 D LQ +E P G+GR+ V S Sbjct: 98 DQLQQEETDAPAGAGRIRKVRS 119 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 428 HATKLIDYLLMRGKLTGSVNRPHHVQGPANTVVG 529 HAT ++ +++ T N P H+ G A VVG Sbjct: 848 HAT--VEMVMIDEGFTFDANHPFHLHGHAFRVVG 879 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,405 Number of Sequences: 2352 Number of extensions: 11870 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -