BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0176 (593 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.1 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 5.9 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 174 KLVTNHFPNISNFNISESYCYVSLYARAILFC 269 KL+ N + NF SE YVSL +FC Sbjct: 117 KLLINLYTINYNFKESERNDYVSLLQLVFVFC 148 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 5.9 Identities = 10/27 (37%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -3 Query: 480 VQRESIRFGNHFSSHHEL--IIRALSE 406 V+++S+ FG S HH L +I++ +E Sbjct: 1294 VRKKSLDFGKLCSLHHHLSKLIKSFNE 1320 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,299 Number of Sequences: 336 Number of extensions: 1796 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -