BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0176 (593 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 2.1 SPAC23G3.03 |sib2||ornithine N5 monooxygenase |Schizosaccharomyc... 25 8.3 >SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 103 Score = 27.1 bits (57), Expect = 2.1 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 80 NSFVLLIYLFVIIYSYLITSI*FSYFSTY 166 N F + IY++ YS+L + F Y S + Sbjct: 75 NKFSIYIYIYFFFYSFLCSPYLFKYISLF 103 >SPAC23G3.03 |sib2||ornithine N5 monooxygenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 431 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 156 FQHINFK-LVTNHFPNISNFNISESYCYVS 242 + H +F L+++ FPN ISE YC ++ Sbjct: 347 YDHESFDVLMSSLFPNSQGAQISEEYCVLN 376 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,771,637 Number of Sequences: 5004 Number of extensions: 28786 Number of successful extensions: 55 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -