BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0176 (593 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 28 4.1 At1g48400.1 68414.m05406 F-box family protein contains F-box dom... 27 9.4 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 5 FLKLINFYLIL*IEIHYTSHHVILTNSFVLLIYLFVIIYSYLITSI 142 F+ ++ +L L IH H L N LIY+ IIY +L+++I Sbjct: 284 FIVFLDEHLGLEQHIHVIYHIFFLINIKTYLIYITWIIYLFLLSTI 329 >At1g48400.1 68414.m05406 F-box family protein contains F-box domain Pfam:PF00646 Length = 513 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 567 PMSFNVYQTKTLVRNI*WIFVLLLKCFVFVQR 472 PMSF +TK L N L +CFV V+R Sbjct: 130 PMSFVAIETKLLTSNTLVKLTLSARCFVEVER 161 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,502,126 Number of Sequences: 28952 Number of extensions: 130164 Number of successful extensions: 224 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -