BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0170 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) 114 8e-26 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 101 6e-22 SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 97 1e-20 SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 78 6e-15 SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) 33 0.18 SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) 32 0.41 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 32 0.54 SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) 31 1.2 SB_41789| Best HMM Match : Mucin (HMM E-Value=0.56) 30 1.6 SB_41192| Best HMM Match : Mucin (HMM E-Value=0.56) 30 1.6 SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) 30 2.2 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) 29 5.0 SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_30106| Best HMM Match : Plasmodium_HRP (HMM E-Value=2.3) 28 6.6 SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_5928| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13) 28 8.8 >SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) Length = 123 Score = 114 bits (274), Expect = 8e-26 Identities = 53/95 (55%), Positives = 69/95 (72%), Gaps = 2/95 (2%) Frame = +1 Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435 +D+ L +F+T +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG GQ Sbjct: 1 MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 60 Query: 436 TREHALLAFTLGVKQLIVGVNKMDS--LNHHTVSP 534 TREHA+L +LGV QLIV +NK+D L +H P Sbjct: 61 TREHAILVRSLGVTQLIVAINKLDMVVLGYHRGKP 95 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 101 bits (242), Expect = 6e-22 Identities = 43/84 (51%), Positives = 61/84 (72%) Frame = +1 Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435 +++ F+T + T++DAPGH+ F+ NMI+G +QAD VL+++A GEFE G + GQ Sbjct: 210 VEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFERGGQ 269 Query: 436 TREHALLAFTLGVKQLIVGVNKMD 507 TREHA+LA T GVK L++ VNKMD Sbjct: 270 TREHAMLAKTAGVKHLVILVNKMD 293 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/40 (42%), Positives = 28/40 (70%) Frame = +3 Query: 126 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245 Y G +DKRT+EK+E+EA+E + ++ +W LD + ER+ Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERD 205 Score = 33.9 bits (74), Expect = 0.13 Identities = 11/24 (45%), Positives = 21/24 (87%) Frame = +3 Query: 522 YSEPRFEEIKKEVSSYIKKIGYNP 593 ++E R+EEIK +++ ++KK+G+NP Sbjct: 299 WNEERYEEIKVKLTPFLKKVGFNP 322 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 97.1 bits (231), Expect = 1e-20 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 42 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 188 M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+ Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEV 49 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 363 IDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ Sbjct: 25 IDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +3 Query: 186 MGKGSFKYAWVLDKLKAERE 245 MGKGSFKYAWVLDKLKAERE Sbjct: 1 MGKGSFKYAWVLDKLKAERE 20 >SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 34.3 bits (75), Expect = 0.10 Identities = 24/70 (34%), Positives = 34/70 (48%) Frame = +1 Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477 +T ID PGH F G + D VL+VAA G ++ ++ HA+ A Sbjct: 78 ITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDGV----KTQTVESIRHAMHAKV---- 129 Query: 478 QLIVGVNKMD 507 LIV +NK+D Sbjct: 130 PLIVAINKID 139 >SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) Length = 541 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = +1 Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486 +D PGH + M+ G + D A+L++A QT EH + +K ++ Sbjct: 69 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 122 Query: 487 VGVNKMD 507 + NK+D Sbjct: 123 ILQNKID 129 >SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 833 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +3 Query: 42 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137 M K+ N+ VI HVD GKST T L+ K G Sbjct: 12 MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAG 43 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402 + + +ID+PGH DF + D A+++V +G Sbjct: 99 FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 135 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 31.9 bits (69), Expect = 0.54 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 235 LSVSRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387 L+ R Q + +F+ + IID PGH F G+S D A+L+V Sbjct: 659 LNAIRIQTKMVKEEFDIKIPGLLIIDTPGHESFSNLRSRGSSLCDMAILVV 709 >SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) Length = 240 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/85 (25%), Positives = 33/85 (38%) Frame = +1 Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441 I + + + +D PGH F G D +++VAA QT+ Sbjct: 128 IGAYSVKVGDQKIAFLDTPGHEAFTAMRARGAQVTDLVIIVVAADDDVMP-------QTK 180 Query: 442 EHALLAFTLGVKQLIVGVNKMDSLN 516 E A GV +I +NK+D N Sbjct: 181 EAISHAQAAGV-PIIFAINKIDKPN 204 >SB_41789| Best HMM Match : Mucin (HMM E-Value=0.56) Length = 683 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 531 PRFEEIKKEVSSYIKKIGYNPAA-VAFVPIFWMARRQHVGAFNQNA 665 PR E KK I++ Y PA +A+VP +W +R + G +N NA Sbjct: 640 PRHEVTKK---FEIERNPYQPAPRMAYVPPYWNLQRLNYGIYNGNA 682 >SB_41192| Best HMM Match : Mucin (HMM E-Value=0.56) Length = 683 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 531 PRFEEIKKEVSSYIKKIGYNPAA-VAFVPIFWMARRQHVGAFNQNA 665 PR E KK I++ Y PA +A+VP +W +R + G +N NA Sbjct: 640 PRHEVTKK---FEIERNPYQPAPRMAYVPPYWNLQRLNYGIYNGNA 682 >SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 359 Score = 29.9 bits (64), Expect = 2.2 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +1 Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402 + I+D PGH+DF ++ + D ++++ G Sbjct: 81 INILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 57 THINIVVIGHVDSGKSTTTGHLIY 128 T I + V+G+V+SGKST G L Y Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTY 134 >SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 462 HPRCQTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGYN 590 H + + RR ++N + + P+FE++K + +S KKI N Sbjct: 109 HETTEPSVRRCQRNSVRDIDAAWPKFEKLKSQFNSNSKKISMN 151 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 66 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 164 N ++ HVD GKST L+ G I K + K Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK 1975 >SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) Length = 125 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 5/58 (8%) Frame = +3 Query: 432 SNP*ACLARFHPRC-----QTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGYN 590 +N A L RF C ++A RR ++N + + P+F+ +K + S KKI N Sbjct: 25 NNEFAALKRFLKNCMHETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMN 82 >SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 462 HPRCQTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGYN 590 H ++A RR ++N + + P+F+ +K + S KKI N Sbjct: 8 HETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMN 50 >SB_30106| Best HMM Match : Plasmodium_HRP (HMM E-Value=2.3) Length = 376 Score = 28.3 bits (60), Expect = 6.6 Identities = 29/84 (34%), Positives = 38/84 (45%) Frame = +1 Query: 427 NGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLATTQLLSL 606 NGQ EH LA TL V+ G ++ +L TV P H R LA L++ Sbjct: 78 NGQ-HEHRALA-TLTVEPGYNGQHEHRALATLTVEPGYNGQ-----HEHRALAA---LTV 127 Query: 607 SCPFSGWHGDNMLEPSTKMPWFKG 678 ++G H D LE T P +KG Sbjct: 128 EPQYNGQHEDRALETLTVEPGYKG 151 >SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/61 (22%), Positives = 31/61 (50%) Frame = +1 Query: 349 TGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528 TGT+ D + + G+F++ ++ N + LLA +G+ + G+ +++ HT Sbjct: 790 TGTNVLDSIISLTPGKIGQFDSSVTMNEDSTSE-LLASIMGLTKTTSGLLVSQTVSTHTT 848 Query: 529 S 531 + Sbjct: 849 A 849 >SB_5928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 28.3 bits (60), Expect = 6.6 Identities = 29/84 (34%), Positives = 38/84 (45%) Frame = +1 Query: 427 NGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLATTQLLSL 606 NGQ EH LA TL V+ G ++ +L TV P H R LA L++ Sbjct: 257 NGQ-HEHRALA-TLTVEPGYNGQHEHRALATLTVEPGYNGQ-----HEHRALAA---LTV 306 Query: 607 SCPFSGWHGDNMLEPSTKMPWFKG 678 ++G H D LE T P +KG Sbjct: 307 EPQYNGQHEDRALETLTVEPGYKG 330 >SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13) Length = 1012 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 562 PHTSRRLATTQLLSLSCP-FSGWHGDNMLEPSTKMPWFKGMAXLEA 696 P T R + L SCP S W D +L ++ W K A + A Sbjct: 608 PETERAVRNEALERESCPKSSAWDWDELLPSDLRLEWSKWEAEMVA 653 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,415,005 Number of Sequences: 59808 Number of extensions: 473577 Number of successful extensions: 1346 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1345 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -