BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0168 (525 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharo... 25 6.9 SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2... 25 9.1 >SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 488 Score = 25.0 bits (52), Expect = 6.9 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 47 NYNLQYFIQASIFSRNLS*NSHNLTQKVKQR*TINIRSADIVRLSL 184 +Y + F ++ I + N+S + N+T V + TI S+D ++L + Sbjct: 188 SYMTKLFARSQILTGNISSKTENITNGVSED-TIGSLSSDTIQLPM 232 >SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 413 Score = 24.6 bits (51), Expect = 9.1 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 249 KDRT-HCSQTGARPARNIFSIFSNRT 323 KDR HC +G P + + S F NR+ Sbjct: 204 KDRCKHCKGSGTVPEQRMLSFFVNRS 229 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,924,689 Number of Sequences: 5004 Number of extensions: 36158 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 214353836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -