BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0167 (486 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 0.57 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 3.0 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.0 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 7.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 7.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 7.0 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.0 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 24.6 bits (51), Expect = 0.57 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 230 CPHGGKLLFGSEPFLN 183 CP +LF S PFLN Sbjct: 383 CPESDSILFVSSPFLN 398 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 38 KSESQNPRRAYGPCEIAS 91 KS S +PR GPC+ S Sbjct: 880 KSPSPSPRPLVGPCKALS 897 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 7.0 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +2 Query: 197 RIQKGACRREDSLFTXREHVKGVTKGFQYKMRAVY 301 ++ G C+ D L T R H++ + + VY Sbjct: 240 QVCSGNCKLNDILLTVRPHLELTFENILSHINTVY 274 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +3 Query: 330 LRVIQLLRYVTSW 368 LR+ +L+RYV+ W Sbjct: 220 LRLSRLVRYVSQW 232 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +3 Query: 330 LRVIQLLRYVTSW 368 LR+ +L+RYV+ W Sbjct: 220 LRLSRLVRYVSQW 232 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +3 Query: 330 LRVIQLLRYVTSW 368 LR+ +L+RYV+ W Sbjct: 220 LRLSRLVRYVSQW 232 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 7.0 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +2 Query: 197 RIQKGACRREDSLFTXREHVKGVTKGFQYKMRAVY 301 ++ G C+ D L T R H++ + + VY Sbjct: 240 QVCSGNCKLNDILLTVRPHLELTFENILSHINTVY 274 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,636 Number of Sequences: 438 Number of extensions: 2756 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -