BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0165 (713 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 83 2e-16 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 83 2e-16 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 83 2e-16 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 83 2e-16 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 83 2e-16 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 77 9e-15 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 74 1e-13 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 68 7e-12 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 68 7e-12 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 63 2e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 62 5e-10 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 58 4e-09 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 56 2e-08 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 46 2e-05 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 42 4e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 41 7e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 41 7e-04 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 41 0.001 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 40 0.002 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 38 0.005 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 38 0.005 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 38 0.009 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 37 0.012 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.012 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.012 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.012 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 37 0.015 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 37 0.015 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 36 0.027 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 36 0.027 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 36 0.027 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 36 0.035 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 36 0.035 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 35 0.047 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 35 0.047 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 35 0.062 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 35 0.062 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 35 0.062 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 34 0.11 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 33 0.19 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 33 0.25 At3g19780.1 68416.m02504 expressed protein 33 0.25 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.25 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 33 0.25 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.33 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 31 0.57 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 31 0.76 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.76 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 1.0 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 1.0 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 30 1.3 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 30 1.3 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 30 1.8 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 30 1.8 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 30 1.8 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 29 2.3 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 2.3 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 5.3 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 7.1 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 9.3 At2g34680.1 68415.m04260 leucine-rich repeat family protein cont... 27 9.3 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 27 9.3 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 27 9.3 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 27 9.3 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 27 9.3 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 82.6 bits (195), Expect = 2e-16 Identities = 33/84 (39%), Positives = 58/84 (69%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 440 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 441 VTSAEQAKELIDANTVIVFGFFST 512 +T+ + A++++ + +V G+ ++ Sbjct: 214 LTTLDDAEKVLTSGNKVVLGYLNS 237 Score = 80.6 bits (190), Expect = 9e-16 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = +1 Query: 67 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 234 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 235 TKLAEEDLL 261 T+L E+ ++ Sbjct: 147 TELKEDGVV 155 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +1 Query: 85 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 255 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L D Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 256 LL 261 L Sbjct: 493 SL 494 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 82.6 bits (195), Expect = 2e-16 Identities = 33/84 (39%), Positives = 58/84 (69%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 440 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 441 VTSAEQAKELIDANTVIVFGFFST 512 +T+ + A++++ + +V G+ ++ Sbjct: 214 LTTLDDAEKVLTSGNKVVLGYLNS 237 Score = 80.6 bits (190), Expect = 9e-16 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = +1 Query: 67 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 234 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 235 TKLAEEDLL 261 T+L E+ ++ Sbjct: 147 TELKEDGVV 155 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +1 Query: 85 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 255 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L D Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 256 LL 261 L Sbjct: 493 SL 494 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 82.6 bits (195), Expect = 2e-16 Identities = 38/87 (43%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +3 Query: 258 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTG 425 P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ I+++LKK++G Sbjct: 81 PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSG 140 Query: 426 PPAVEVTSAEQAKELIDANTVIVFGFF 506 P +VE+ SA+ A E++ V+ G F Sbjct: 141 PASVEIKSADSATEVVGEKNVVAVGVF 167 Score = 71.7 bits (168), Expect = 4e-13 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +1 Query: 49 FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 222 F+ + LL L + T+E VL L +NF I+ ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 223 AKAATKLAEED 255 KAA++L+ + Sbjct: 69 EKAASELSSHN 79 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +1 Query: 91 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 216 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +3 Query: 267 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 422 +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 82.6 bits (195), Expect = 2e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +3 Query: 258 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 425 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 426 PPAVEVTSAEQAKELIDANTVIVFGFF 506 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +1 Query: 49 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 210 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 211 APEYAKAATKLA 246 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 48.0 bits (109), Expect = 6e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +1 Query: 91 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 216 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 255 SPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 413 S + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 425 SSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 82.6 bits (195), Expect = 2e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +3 Query: 258 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 425 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 426 PPAVEVTSAEQAKELIDANTVIVFGFF 506 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +1 Query: 49 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 210 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 211 APEYAKAATKLA 246 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 48.0 bits (109), Expect = 6e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +1 Query: 91 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 216 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 4/75 (5%) Frame = +3 Query: 255 SPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK---T 422 S + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K Sbjct: 425 SSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTV 484 Query: 423 GPPAVEVTSAEQAKE 467 G P E + E+ K+ Sbjct: 485 GEPKKEEETTEEVKD 499 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 77.4 bits (182), Expect = 9e-15 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 1/83 (1%) Frame = +3 Query: 267 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 443 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 444 TSAEQAKELIDANTVIVFGFFST 512 T+ E+A+ ++ A +VFGF ++ Sbjct: 211 TTKEEAERVLSAEPKLVFGFLNS 233 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +1 Query: 100 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 243 E++V VL+K NF + + +VEFYAPWCG C++L PEYA AAT+L Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145 Score = 48.0 bits (109), Expect = 6e-06 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 3/83 (3%) Frame = +1 Query: 22 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 192 +NI+ F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 193 GHCKSLAPEYAKAATKLAEEDLL 261 GHC+S P Y K L D L Sbjct: 468 GHCQSFEPIYNKLGKYLKGIDSL 490 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 73.7 bits (173), Expect = 1e-13 Identities = 29/84 (34%), Positives = 50/84 (59%) Frame = +3 Query: 255 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 434 S + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ W++KKTG P Sbjct: 128 SSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPI 187 Query: 435 VEVTSAEQAKELIDANTVIVFGFF 506 + + + ++A +D V G F Sbjct: 188 ITLNTVDEAPRFLDKYHTFVLGLF 211 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +1 Query: 109 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 249 VL L+ + VI E+++V YAPWC L P +A+AAT L E Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKE 125 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 67.7 bits (158), Expect = 7e-12 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +1 Query: 103 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 255 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +E+ Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = +1 Query: 46 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 225 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 226 K--AATKLAEEDLLS 264 K A+ K A+ L++ Sbjct: 64 KLGASFKKAKSVLIA 78 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 425 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 48.0 bits (109), Expect = 6e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 425 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 67.7 bits (158), Expect = 7e-12 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +1 Query: 103 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 255 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +E+ Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = +1 Query: 46 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 225 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 226 K--AATKLAEEDLLS 264 K A+ K A+ L++ Sbjct: 64 KLGASFKKAKSVLIA 78 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 425 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 48.0 bits (109), Expect = 6e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 425 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 63.3 bits (147), Expect = 2e-10 Identities = 24/84 (28%), Positives = 49/84 (58%) Frame = +3 Query: 255 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 434 S + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ W++KKTG Sbjct: 126 SSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGAST 185 Query: 435 VEVTSAEQAKELIDANTVIVFGFF 506 +++ + ++A + + + G F Sbjct: 186 IKLDTVDEASGFLKKHHTFILGLF 209 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +1 Query: 109 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 249 V+ L+ N + +I EY++V YAPWC L P +A+AAT L E Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKE 123 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +1 Query: 85 DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 249 D+ + VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE AA LA+ Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAK 80 Score = 54.8 bits (126), Expect = 5e-08 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = +3 Query: 252 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 431 + PI +AK++A + LA + +PTL + +G P++Y G R+AD ++ +LKK P Sbjct: 82 KQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPD 141 Query: 432 AVEVTSAEQAKELI-DANT 485 + S KE + DA T Sbjct: 142 VAVLESDSTVKEFVEDAGT 160 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 58.4 bits (135), Expect = 4e-09 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 118 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 243 L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA L Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL 210 Score = 54.8 bits (126), Expect = 5e-08 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +1 Query: 109 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 243 VL L+ +NF++ V+ + +LVEF+APWCGHC+SL P + K A+ L Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75 Score = 47.6 bits (108), Expect = 8e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +3 Query: 267 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 419 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 7/91 (7%) Frame = +3 Query: 252 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LK 413 + +KL V+ EQ + + V+G+PT+ F + SP+ Y G R A I S+ L+ Sbjct: 211 KGKVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLE 270 Query: 414 KKTGPPAV-EVTSAEQAKELIDANTVIVFGF 503 GP V E+T + ++ + + F Sbjct: 271 SNAGPAEVTELTGPDVMEDKCGSAAICFVSF 301 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 56.0 bits (129), Expect = 2e-08 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +1 Query: 118 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 243 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ +AA L Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL 209 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +1 Query: 109 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 243 V+ L+ +NF++ V+ + +LVEF+APWCGHCK+L P + K A L Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 267 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 419 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 35.5 bits (78), Expect = 0.035 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKK--KTGP 428 +KL V+ EQ + + V+G+PT+ F SP Y G R A I S+ + ++ Sbjct: 213 VKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVESSA 272 Query: 429 PAVEVT 446 VEVT Sbjct: 273 GPVEVT 278 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 82 GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 249 GDE E E+ + L+ NF+T ++V FYAPWC C L P + KAA ++ E Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKE 189 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +3 Query: 267 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 365 LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +1 Query: 100 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 234 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K A Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 41.1 bits (92), Expect = 7e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +1 Query: 100 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 234 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 41.1 bits (92), Expect = 7e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +1 Query: 100 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 234 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 88 EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 246 E+ NV+ LSK E ++ E LV YAPWC C+++ Y + A KLA Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLA 392 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 25 NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 198 +I RV T IA L L + + ++ L S +E ++ + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 199 CKSLAPEYAK 228 C+ LAP+ K Sbjct: 153 CRELAPDVYK 162 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 38.3 bits (85), Expect = 0.005 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 124 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 261 K+ + T + +++EF A WCG CK+L P+ + A K + + + Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFV 94 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 97 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 246 T + V++ + +++ V+ E + V+F+APWCG CK + P + A K A Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYA 122 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 264 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 404 K K++ + YGVR PT+ F NG D G + D ++ Sbjct: 126 KFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLA 172 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 37.5 bits (83), Expect = 0.009 Identities = 13/42 (30%), Positives = 28/42 (66%) Frame = +1 Query: 124 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 249 K+ F+++ + + ++++F A WCG CK++ P + A+K +E Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSE 74 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +1 Query: 103 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 246 EN++ LS+ E ++ E +V YAPWC C+++ Y + A KLA Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLA 403 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 97 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 216 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 118 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 216 LS + ++T + ++ +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 264 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 368 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +3 Query: 273 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 425 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 151 TTEYILVEFYAPWCGHCKSLAPEYAKAATK 240 + + I+++F A WC C+ +AP + A K Sbjct: 27 SNKLIVIDFTASWCPPCRMIAPIFNDLAKK 56 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 36.7 bits (81), Expect = 0.015 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +1 Query: 52 TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 225 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 226 KAA 234 KAA Sbjct: 182 KAA 184 Score = 35.5 bits (78), Expect = 0.035 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 410 + L VD T+E L + ++GYP+++ FR GS + Y G R D I+ + Sbjct: 199 VLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMV 258 Query: 411 KKKTGP 428 + P Sbjct: 259 EGLVAP 264 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 410 + L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ + Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 411 KKKTGP 428 ++ P Sbjct: 260 EELLKP 265 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 118 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 234 L+ A FE + ++V FYAPWC L P + KA+ Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKAS 185 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.9 bits (79), Expect = 0.027 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +1 Query: 88 EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAA 234 E T N+L + AN ++++ + ++V +FY+P CG CKSL P+ + A Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 35.9 bits (79), Expect = 0.027 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +3 Query: 273 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 452 +V+A + +++E+Y V P FF++G +D G AD S L K G A TSA Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112 Query: 453 EQA 461 E A Sbjct: 113 EPA 115 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 35.9 bits (79), Expect = 0.027 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +3 Query: 312 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 461 YGV G+PTL + Y G R D ++++ TG ++ TS E++ Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 35.5 bits (78), Expect = 0.035 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +1 Query: 70 GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 240 G A ++ ENV+ LS+ E ++ E +V YAPWC C+++ + + A K Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394 Query: 241 L 243 L Sbjct: 395 L 395 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 35.5 bits (78), Expect = 0.035 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 261 ++V+F++P CG CK+L P+ K A K E + L Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVEFL 148 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATKL 243 ++V+F A WCG C+ +AP +A A KL Sbjct: 31 VVVDFTASWCGPCRFIAPFFADLAKKL 57 Score = 31.1 bits (67), Expect = 0.76 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +3 Query: 273 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 416 KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 139 TVITTTEYILVEFYAPWCGHCKSLAP 216 TV+ + + +LVEF A WCG CK + P Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYP 107 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 34.7 bits (76), Expect = 0.062 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 34.7 bits (76), Expect = 0.062 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 34.7 bits (76), Expect = 0.062 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAA 234 ++V+FY WCG C+++ P+ K A Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKTA 139 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +3 Query: 405 WLKKKTGPPAVEVTSAEQ-AKELIDA-NTVIVFGFFST 512 W ++K GP +++TSAEQ L DA + +++ F+ T Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDFYGT 123 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 33.9 bits (74), Expect = 0.11 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 ++++ Y WCG CK +AP+Y + + K Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEK 125 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 33.1 bits (72), Expect = 0.19 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 ++++ Y WCG CK +AP+Y + K Sbjct: 90 VVLDMYTQWCGPCKVIAPKYKALSEK 115 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 32.7 bits (71), Expect = 0.25 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +1 Query: 130 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 261 +F + + + ++V+F A WCG C+ + P A K + D + Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFV 82 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 32.7 bits (71), Expect = 0.25 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 115 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 261 +L++ NF + I ++L+ PWCG +SL E + + E LL Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQRREEFGLL 77 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.25 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +1 Query: 130 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 216 +FE ++ ++ +LV++YA WCG C+ + P Sbjct: 72 SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 252 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 401 + I++ K+D + +A Y + PT F++G P D + G A +I Sbjct: 111 KDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 32.7 bits (71), Expect = 0.25 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 273 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 425 K+D + Q +A+ + V PT F + G+ ID G D+I L K G Sbjct: 63 KIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 Score = 31.5 bits (68), Expect = 0.57 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 I+++F A WC C+ +AP +A+ A K Sbjct: 30 IVIDFTASWCPPCRFIAPVFAEMAKK 55 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.33 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAP 216 +LV+FYA WCG C+ + P Sbjct: 79 VLVDFYATWCGPCQLMVP 96 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 401 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 31.5 bits (68), Expect = 0.57 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 249 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 368 + S + KVD + D+A S+ + PT F R+G +D Sbjct: 320 QHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 Score = 31.1 bits (67), Expect = 0.76 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 +++ F A WCG C+ ++P Y+ AT+ Sbjct: 295 LILYFTATWCGPCRYMSPLYSNLATQ 320 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 31.1 bits (67), Expect = 0.76 Identities = 20/60 (33%), Positives = 31/60 (51%) Frame = +3 Query: 273 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 452 +V+A + +++E+Y V P FF++G +D G AD S L K G A +T A Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSITPA 112 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.1 bits (67), Expect = 0.76 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 136 ETVITTTEYILVEFYAPWCGHCK 204 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 I+++F A WC C+ +AP +A A K Sbjct: 30 IVIDFTATWCPPCRFIAPVFADLAKK 55 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 273 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 416 KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 63 KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 312 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 425 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 ++V+FYA WCG C +A E A + Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVE 122 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAA 234 ++V+F++P CG CK+L P+ + A Sbjct: 120 VVVDFFSPGCGGCKALHPKICQFA 143 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 437 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 438 EVTSAEQAKEL 470 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 109 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 210 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 437 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 438 EVTSAEQAKEL 470 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 109 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 210 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +3 Query: 261 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 437 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 438 EVTSAEQAKEL 470 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 109 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 210 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 163 ILVEFYAPWCGHCKSLAPEYAKAATK 240 ++ F A WCG CK +AP + + + K Sbjct: 48 VVANFSATWCGPCKIVAPFFIELSEK 73 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 249 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 365 + S + VD + D + S+ ++ PT F +NG I Sbjct: 73 KHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQI 111 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 154 TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 252 T +++V F A WCG C+ + P K ++ E Sbjct: 227 TPHVMVMFTARWCGPCRDMIPILNKMDSEYKNE 259 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 276 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 398 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 475 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 374 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 276 VDATQEQDLAESYGVRGYPTLKFFRNGSPI 365 VD + LA++ +R PT K ++NG + Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671 >At2g34680.1 68415.m04260 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; identical to cDNA hypothetical protein (AIR9) mRNA, partial cds GI:3695020 Length = 1661 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +3 Query: 366 DYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELI---DANTVIVFGFFSTRAQPEPKL 536 DY GG++ WL+K + + SA ++ + D T + F + + PK+ Sbjct: 683 DYFGGKEGPSKFEWLRKNKETGELSLISAGTSEYTLTQEDVGTHVTFVYIPANFEAPPKV 742 Query: 537 S 539 + Sbjct: 743 T 743 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 249 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 365 R I KVD + + + VR PT+K ++NGS + Sbjct: 641 RYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 27.5 bits (58), Expect = 9.3 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +1 Query: 151 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 255 T ++V+FY CG CK + ++K + +++ Sbjct: 119 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 153 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 27.5 bits (58), Expect = 9.3 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +1 Query: 151 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 255 T ++V+FY CG CK + ++K + +++ Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 140 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 27.5 bits (58), Expect = 9.3 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +1 Query: 151 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 255 T ++V+FY CG CK + ++K + +++ Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,156,686 Number of Sequences: 28952 Number of extensions: 281383 Number of successful extensions: 917 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 905 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -