BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0163 (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 57 6e-10 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 26 1.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.1 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 9.5 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 56.8 bits (131), Expect = 6e-10 Identities = 31/60 (51%), Positives = 37/60 (61%) Frame = +2 Query: 497 PRYFMTLKDKPQKMQVPSLGLNVLRIINEPTAAAIAYGLGQKGYWENEMYFIFDFGGGTF 676 P YF + + K GLNV+RIINEPTAAA+AYGL + E + IFD GGGTF Sbjct: 7 PAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNV-LIFDLGGGTF 65 Score = 45.6 bits (103), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +1 Query: 478 NAVITVPAVLHDSQRQATKDAGTISGL 558 +AVITVPA +DSQRQATKDAG I+GL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGL 27 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 658 VKDKVHFVLPVPFLSKTVSNRSSSRFIDDSENVQAQRW 545 VKD HF+ P + S+ S++ F N+ QRW Sbjct: 96 VKDFDHFINHRPLMKADNSSNSTAMFSKILFNLTGQRW 133 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.1 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 58 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 159 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 412 VSSMVLTKMKETAEAYLGKTVQNAVITVPAVLHDSQRQATKDAGT 546 VS ++ +AY+G QNA + V +L ++A + G+ Sbjct: 967 VSELIDAYGLSVVQAYMGHMQQNAELAVRDMLRTIAQEARERTGS 1011 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 788,823 Number of Sequences: 2352 Number of extensions: 17993 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -