BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0161 (363 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 29 0.85 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 28 2.0 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 27 3.4 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 27 4.6 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 27 6.0 SB_14778| Best HMM Match : MH1 (HMM E-Value=2.8026e-45) 27 6.0 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_23555| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_20637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) 26 8.0 SB_13327| Best HMM Match : Viral_cys_rich (HMM E-Value=8.3) 26 8.0 SB_54770| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_37561| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 29.5 bits (63), Expect = 0.85 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSS 297 +R+ HPPFA W + +TD S+ +R +N R+ L TH S SS Sbjct: 670 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLSRSS 718 >SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.7 bits (61), Expect = 1.5 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINS-RWISVRIINRVKLPLLRTH 282 +R+ HPPFA W + T+TD S + +S + R+ L TH Sbjct: 33 NRLAAHPPFASWRNSEETRTDRPSQQLLSQNVEWRLMRYFLLTH 76 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 28.3 bits (60), Expect = 2.0 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIINRVKLPLLRTHRSNS 294 +R+ HPPFA W + +TD S+ +R +N + L+R RS S Sbjct: 216 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNG-EWRLMRPQRSES 259 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 2.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ HPPFA WS+ +TD Sbjct: 83 NRLAAHPPFASWSNSEEARTD 103 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 2.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ HPPFA WS+ +TD Sbjct: 56 NRLAAHPPFASWSNSEEARTD 76 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 2.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ HPPFA WS+ +TD Sbjct: 83 NRLAAHPPFASWSNSEEARTD 103 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 27.5 bits (58), Expect = 3.4 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIINRVKLPLLRTHRS 288 +R+ HPPFA W + +TD S+ +R +N + L+RT R+ Sbjct: 69 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNG-EWRLMRTKRN 110 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 46 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 96 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 125 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 50 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 100 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 42 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 92 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 107 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 102 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 62 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 112 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 104 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSS 297 +R+ HPPFA W + +TD S+ +R +N R+ L TH +S Sbjct: 113 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRDFLLTHLCGTS 161 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 124 TSKRRKMIAPHRIIMHPPFA*WSDWSTTKTD 216 T K + +R+ HPPFA W + +TD Sbjct: 16 TGKTLSVTQLNRLAAHPPFASWRNSEEARTD 46 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 107 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 38 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 88 >SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 27.1 bits (57), Expect = 4.6 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -2 Query: 299 IDEFDLCVLNNGSFTLLIILTEIHRLLMSVFVVLQSLHYANGGCMM--ILWGAII 141 I+ ++CV++ +FT + +T++H L SV V + YA C +L+G + Sbjct: 896 IEWLEMCVVHVSTFTAELSITDMHSLSPSVLKVAK---YAYEHCQQSEVLYGTFL 947 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 39 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 89 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 55 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 105 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 39 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 89 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 124 TSKRRKMIAPHRIIMHPPFA*WSDWSTTKTD 216 T K + +R+ HPPFA W + +TD Sbjct: 16 TGKNTGVTQLNRLAAHPPFASWRNSEEARTD 46 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN---RVKLPLLRTHRSNSSIK 303 +R+ HPPFA W + +TD S+ +R +N R+ L TH + +K Sbjct: 72 NRLAAHPPFASWRNSEEARTDRPSQ--QLRSLNGEWRLMRYFLLTHLCETLVK 122 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 124 TSKRRKMIAPHRIIMHPPFA*WSDWSTTKTD 216 T K + +R+ HPPFA W + +TD Sbjct: 16 TGKNTGVTQLNRLAAHPPFASWRNSEEARTD 46 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 26.6 bits (56), Expect = 6.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ +HPPFA W + +TD Sbjct: 74 NRLAVHPPFASWRNSEEARTD 94 >SB_14778| Best HMM Match : MH1 (HMM E-Value=2.8026e-45) Length = 1133 Score = 26.6 bits (56), Expect = 6.0 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 129 TRVLLSVDRYQINPPIEKFL 70 T VLLS+++Y+ PPIE +L Sbjct: 542 TLVLLSMNKYEDLPPIESYL 561 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN 252 +R+ HPPFA W + +TD S+ VR +N Sbjct: 26 NRLAAHPPFASWRNSEEARTDRPSQ--QVRSLN 56 >SB_23555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 26.6 bits (56), Expect = 6.0 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -2 Query: 209 FVVLQSLHYANGGCMMILWGAIIFLRLLVFYCPLIDTKLILPLKNSYTTRQTGRNTM 39 ++ LQS+ YA G ++I GA+I L C I L + RQ NT+ Sbjct: 14 YIDLQSVKYATGYIIVIAAGALIALISFFGCCGAIKESRCLLAAVNQKLRQDMNNTL 70 >SB_20637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +RI HPPFA W + +TD Sbjct: 95 NRIAAHPPFASWRNSEEARTD 115 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 26.6 bits (56), Expect = 6.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 124 TSKRRKMIAPHRIIMHPPFA*WSDWSTTKTD 216 T K + +R+ HPPFA W + +TD Sbjct: 16 TGKNPGVTQLNRLAAHPPFASWRNSEEARTD 46 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ HPPFA W + +TD Sbjct: 85 NRLAAHPPFASWGNSEEARTD 105 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 124 TSKRRKMIAPHRIIMHPPFA*WSDWSTTKTD 216 T K + +R+ HPPFA W + +TD Sbjct: 14 TGKTLGVTQLNRLAAHPPFASWRNSEEARTD 44 >SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) Length = 1287 Score = 26.2 bits (55), Expect = 8.0 Identities = 17/61 (27%), Positives = 31/61 (50%) Frame = -2 Query: 302 LIDEFDLCVLNNGSFTLLIILTEIHRLLMSVFVVLQSLHYANGGCMMILWGAIIFLRLLV 123 L D+ ++ GS +L+++ I+ L+ + V + Y N G + IIFL L++ Sbjct: 493 LPDKNEIQAYQKGSLIVLLLIV-INFTLVFLIVRFREPDYLNLGLSCVFAITIIFLGLII 551 Query: 122 F 120 F Sbjct: 552 F 552 >SB_13327| Best HMM Match : Viral_cys_rich (HMM E-Value=8.3) Length = 321 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 131 LLVFYCPLIDTKLILPLKNSYTT 63 + +F CP I+ + +L LKN ++T Sbjct: 270 IYIFKCPKINQQFVLDLKNLFST 292 >SB_54770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 26.2 bits (55), Expect = 8.0 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = -2 Query: 359 HHVALGCMTTKSRGHQLYDLIDE--FDLCVLNN--GSFTLLIILTEIHRLLMSVFVVLQS 192 H V G + GH LYD D+ D+ ++ +++I+ I +LM V + + + Sbjct: 20 HGVETGAVMWTPVGHPLYDNYDDDVGDMMIMKKMMTVIVMMMIIIIILMILMMVMMTMMT 79 Query: 191 LH 186 +H Sbjct: 80 MH 81 >SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 26.2 bits (55), Expect = 8.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTDINSRWISVRIIN 252 +R+ HPPFA W + ++D S+ +RI+N Sbjct: 26 NRLAAHPPFASWRNSEEARSDRPSQ--QLRILN 56 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 124 TSKRRKMIAPHRIIMHPPFA*WSDWSTTKTD 216 T K + +R+ HPPFA W + +TD Sbjct: 16 TGKTPGVTQLNRLAAHPPFASWRNSEEARTD 46 >SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ HPPFA W + +TD Sbjct: 77 NRLAAHPPFASWRNTEEARTD 97 >SB_37561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1209 Score = 26.2 bits (55), Expect = 8.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -2 Query: 278 VLNNGSFTLLIILTEIHRLL--MSVFVVLQSLHYANGGCMMILWGAI 144 +L G+FT +I + I + SV V + + YA+G I+W AI Sbjct: 731 LLMRGAFTYVISVQAITVAIGPPSVIVTITTPEYADGSNHTIIWNAI 777 >SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ +HPPFA W +TD Sbjct: 70 NRLAVHPPFASWRSSEEARTD 90 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ HPPFA W + +TD Sbjct: 149 NRLAAHPPFASWGNSEKARTD 169 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 154 HRIIMHPPFA*WSDWSTTKTD 216 +R+ HPPFA W + +TD Sbjct: 85 NRLAAHPPFASWRNTEEARTD 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,175,573 Number of Sequences: 59808 Number of extensions: 217901 Number of successful extensions: 3883 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 3852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3883 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -