BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0161 (363 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC064404-1|AAH64404.1| 719|Homo sapiens nucleolar protein 11 pr... 28 7.8 BC001726-1|AAH01726.2| 408|Homo sapiens NOL11 protein protein. 28 7.8 AY598333-1|AAT06744.1| 719|Homo sapiens L14 protein. 28 7.8 AL110271-1|CAB53709.1| 314|Homo sapiens hypothetical protein pr... 28 7.8 AK023702-1|BAB14647.1| 719|Homo sapiens protein ( Homo sapiens ... 28 7.8 >BC064404-1|AAH64404.1| 719|Homo sapiens nucleolar protein 11 protein. Length = 719 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/31 (29%), Positives = 25/31 (80%) Frame = -2 Query: 284 LCVLNNGSFTLLIILTEIHRLLMSVFVVLQS 192 +C+L + +FT+++++ E RLL++++ +++S Sbjct: 650 ICLLLDANFTVVVMMPEAKRLLINLYKLVKS 680 >BC001726-1|AAH01726.2| 408|Homo sapiens NOL11 protein protein. Length = 408 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/31 (29%), Positives = 25/31 (80%) Frame = -2 Query: 284 LCVLNNGSFTLLIILTEIHRLLMSVFVVLQS 192 +C+L + +FT+++++ E RLL++++ +++S Sbjct: 339 ICLLLDANFTVVVMMPEAKRLLINLYKLVKS 369 >AY598333-1|AAT06744.1| 719|Homo sapiens L14 protein. Length = 719 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/31 (29%), Positives = 25/31 (80%) Frame = -2 Query: 284 LCVLNNGSFTLLIILTEIHRLLMSVFVVLQS 192 +C+L + +FT+++++ E RLL++++ +++S Sbjct: 650 ICLLLDANFTVVVMMPEAKRLLINLYKLVKS 680 >AL110271-1|CAB53709.1| 314|Homo sapiens hypothetical protein protein. Length = 314 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/31 (29%), Positives = 25/31 (80%) Frame = -2 Query: 284 LCVLNNGSFTLLIILTEIHRLLMSVFVVLQS 192 +C+L + +FT+++++ E RLL++++ +++S Sbjct: 245 ICLLLDANFTVVVMMPEAKRLLINLYKLVKS 275 >AK023702-1|BAB14647.1| 719|Homo sapiens protein ( Homo sapiens cDNA FLJ13640 fis, clone PLACE1011221. ). Length = 719 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/31 (29%), Positives = 25/31 (80%) Frame = -2 Query: 284 LCVLNNGSFTLLIILTEIHRLLMSVFVVLQS 192 +C+L + +FT+++++ E RLL++++ +++S Sbjct: 650 ICLLLDANFTVVVMMPEAKRLLINLYKLVKS 680 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,896,648 Number of Sequences: 237096 Number of extensions: 1008282 Number of successful extensions: 1667 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1667 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2248517154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -