BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0160 (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 1.9 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 23 1.9 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 23 1.9 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -2 Query: 487 SGHELNAKGPVTKRQTAGQNSNKYNPLACMSTSEENANSSYL 362 S L + P ++ G N++ L C++T N + L Sbjct: 224 SSSALESPNPASRSSCLGSNTSSMLSLNCLNTGRTNFTNKQL 265 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -2 Query: 487 SGHELNAKGPVTKRQTAGQNSNKYNPLACMSTSEENANSSYL 362 S L + P ++ G N++ L C++T N + L Sbjct: 13 SSSALESPNPASRSSCLGSNTSSMLSLNCLNTGRTNFTNKQL 54 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -2 Query: 487 SGHELNAKGPVTKRQTAGQNSNKYNPLACMSTSEENANSSYL 362 S L + P ++ G N++ L C++T N + L Sbjct: 13 SSSALESPNPASRSSCLGSNTSSMLSLNCLNTGRTNFTNKQL 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,121 Number of Sequences: 336 Number of extensions: 3489 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -