BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0160 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 5.6 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 23 9.8 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 514 HIRLRNNGLSGHELNAKGPVTKRQTAGQNSNKYN 413 +I N+ +G EL GP ++ G+N + ++ Sbjct: 697 NIHYLNDRPAGSELTPPGPPDEKDVCGENEDNFD 730 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 523 PPPEFHFGNFKTAKT 567 P P F FG+FK A T Sbjct: 38 PKPTFFFGSFKDAGT 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,193 Number of Sequences: 2352 Number of extensions: 15339 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -