BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0158 (691 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132943-12|CAB81978.3| 514|Caenorhabditis elegans Hypothetical... 31 0.78 Z49130-1|CAA88965.2| 708|Caenorhabditis elegans Hypothetical pr... 27 9.6 AL031630-22|CAA20995.2| 454|Caenorhabditis elegans Hypothetical... 27 9.6 >AL132943-12|CAB81978.3| 514|Caenorhabditis elegans Hypothetical protein Y116F11B.9a protein. Length = 514 Score = 31.1 bits (67), Expect = 0.78 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 Query: 15 PSYKPQRITV*KQILYVFPQ*TNFLKYIH 101 PSYKP+ V LYVF Q NFL +H Sbjct: 160 PSYKPRDFVVCLSPLYVFEQWQNFLLSVH 188 >Z49130-1|CAA88965.2| 708|Caenorhabditis elegans Hypothetical protein T06D8.2 protein. Length = 708 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 361 KVCYFLNFWVHKDKEDFINNLNSYLGTXXXXXFSKHLTS 477 ++C L V + D INNL S +G F K+L S Sbjct: 100 EICSMLLLSVSEAHADVINNLESLVGLVDVKLFGKYLPS 138 >AL031630-22|CAA20995.2| 454|Caenorhabditis elegans Hypothetical protein Y38H6C.17 protein. Length = 454 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = -2 Query: 312 KVRSNTEMIH*RKMRPYQTRLINVVLVLNHQLSLANMTKFL 190 KV N ++IH K+ PY RL +++ L+ L++ N+T+ + Sbjct: 344 KVSENRKLIH--KILPYALRLSLMLVSLSLALAVPNLTEII 382 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,377,455 Number of Sequences: 27780 Number of extensions: 278985 Number of successful extensions: 703 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -