BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0156 (644 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 25 2.0 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 25 2.0 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 25 2.0 AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding pr... 25 2.7 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 23 8.3 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 555 DVQSSYIGGMRCSQTTD----NLXVPPGRRWINL 644 D Q+ + G+ C++ D NL PG+RW NL Sbjct: 92 DFQNFHDRGVYCNEEHDPFSANLFALPGQRWKNL 125 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 555 DVQSSYIGGMRCSQTTD----NLXVPPGRRWINL 644 D Q+ + G+ C++ D NL PG+RW NL Sbjct: 92 DFQNFHDRGVYCNEEHDPFSANLFALPGQRWKNL 125 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 555 DVQSSYIGGMRCSQTTD----NLXVPPGRRWINL 644 D Q + G+ C++ +D NL PG+RW NL Sbjct: 92 DFQHFHDRGVYCNEHSDPMSANLFALPGQRWKNL 125 >AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding protein AgamOBP27 protein. Length = 119 Score = 24.6 bits (51), Expect = 2.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 572 VGRLDIQILKLTLELVH*CRN 510 +GRLD+ L + LVH CRN Sbjct: 1 MGRLDLVCLLAIVLLVHSCRN 21 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 588 IAFLQCRTTGHPNPQTDSRTC 526 I F C+ P P +SR C Sbjct: 216 IGFSSCKVREAPKPSAESRRC 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,749 Number of Sequences: 2352 Number of extensions: 8756 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -