BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0153 (571 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0176 - 13826764-13827064,13827271-13827377,13827474-138278... 27 8.0 >10_07_0176 - 13826764-13827064,13827271-13827377,13827474-13827836, 13827912-13828079,13828153-13828374,13828784-13829023, 13829640-13829719,13829853-13830018,13830720-13830783, 13830861-13830962,13831085-13831227,13831370-13831474, 13831551-13831706,13832125-13832241,13832315-13832392, 13832466-13832550,13833334-13833455,13833546-13833611, 13835190-13835284,13835427-13835523,13835873-13835983, 13836083-13836164,13836292-13836353,13836620-13836685, 13838002-13838232 Length = 1142 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 181 CQESFKQCLAICEGVVPYGKLIEWKQFHQKLSDSE 285 C+E F+ CLA+C V+P G+ K +Q S E Sbjct: 490 CKEFFR-CLALCHTVLPEGEETPEKISYQAASPDE 523 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,274,155 Number of Sequences: 37544 Number of extensions: 209841 Number of successful extensions: 318 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -