BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0150 (551 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.02 |imp2||contractile ring protein Imp2|Schizosaccharo... 25 5.6 SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyce... 25 7.4 >SPBC11C11.02 |imp2||contractile ring protein Imp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 670 Score = 25.4 bits (53), Expect = 5.6 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 383 LPKDSLGLVRS*FKLSRYVLEIDSVPLCESYKL 481 +P DS+ LV++ F+ ++ +E D++PL Y L Sbjct: 297 VPDDSVELVQANFQRAQTKIENDNMPLNRPYVL 329 >SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 715 Score = 25.0 bits (52), Expect = 7.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 146 EDPLKWXGSPSENFRYFKQLLCAC 217 ED W + F YF Q+ C+C Sbjct: 654 EDAENWQCQHCKAFSYFSQVACSC 677 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,151,831 Number of Sequences: 5004 Number of extensions: 41104 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -