BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0150 (551 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0302 - 24255456-24255935,24256723-24257604 28 5.7 02_04_0193 - 20801959-20802583,20803372-20803448,20803530-208036... 27 7.5 >04_04_0302 - 24255456-24255935,24256723-24257604 Length = 453 Score = 27.9 bits (59), Expect = 5.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 434 YVLEIDSVPLCESYKLKY 487 Y L+I+ P+C++YKL Y Sbjct: 375 YALDIEMCPICQNYKLVY 392 >02_04_0193 - 20801959-20802583,20803372-20803448,20803530-20803646, 20804147-20804250,20804359-20804428,20804547-20804644, 20804747-20804840,20805269-20805359,20805453-20805545, 20805635-20805960,20806162-20806641 Length = 724 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 361 LSYRSNGLFVQIVLKMYPATSRRIHRNNATA 269 LS+R+ GL V+ LK +PA + ++ + TA Sbjct: 18 LSFRAMGLVVEQELKAFPAVAGKVQGKHKTA 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,234,976 Number of Sequences: 37544 Number of extensions: 242319 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -