BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0150 (551 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71420.1 68414.m08249 pentatricopeptide (PPR) repeat-containi... 29 2.1 At2g27505.1 68415.m03326 expressed protein ; expression supporte... 28 4.8 >At1g71420.1 68414.m08249 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 745 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 465 VNLIS*STSNKLCISCHNIFKL 530 VNLI + ++CI CHN KL Sbjct: 693 VNLIQIMKNTRICIDCHNFMKL 714 >At2g27505.1 68415.m03326 expressed protein ; expression supported by MPSS Length = 282 Score = 27.9 bits (59), Expect = 4.8 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +2 Query: 377 LRLPKDSLGLVRS*FKLSRY-VLEIDSVPLCESYKLKYIK 493 L +P+ +L LV+ F + +++ +VPLC LKY+K Sbjct: 183 LTMPRSNLDLVQDYFYSCKPGEIDLTNVPLCMQSTLKYVK 222 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,967,907 Number of Sequences: 28952 Number of extensions: 206882 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -