BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0149 (587 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0145 + 1204021-1204296,1204430-1204492,1204667-1204795,120... 30 1.6 05_03_0453 - 14223012-14223175,14223956-14223992,14224171-142243... 27 8.4 >11_01_0145 + 1204021-1204296,1204430-1204492,1204667-1204795, 1205778-1205834,1205915-1206213,1206539-1206630, 1206747-1206961,1207142-1207325,1207447-1207541, 1208572-1208628,1209372-1209426,1209955-1210079 Length = 548 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 408 YIKIIYQKRRDYYN**LIFIHKYITHGAAAARCSRQRRPRAP 283 YI Y K RDY I++H Y+ +GA A+R +R P Sbjct: 258 YITEEYLKGRDYN----IYVHSYLHYGAQASRVEILKRKNGP 295 >05_03_0453 - 14223012-14223175,14223956-14223992,14224171-14224312, 14224858-14225038,14225460-14225655 Length = 239 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/53 (24%), Positives = 31/53 (58%) Frame = +3 Query: 42 IKMYTYLSTRLSEPTSVGLSIILLSIKDYLFEKFEKKLRYINKKSLIDKEARY 200 +K Y +S +++ +SV ++ L+EK+E ++ + +K+LI+ + +Y Sbjct: 168 LKTYLMISLQITT-SSVSQFFLMAYTLPMLYEKYEDEVDVVGEKALIELKKQY 219 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,717,428 Number of Sequences: 37544 Number of extensions: 205783 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -