BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0145 (537 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U61151-1|AAB41306.1| 45|Tribolium castaneum TATH1 protein. 22 3.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 3.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 3.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.9 EF127809-1|ABL67946.1| 311|Tribolium castaneum nicotinic acetyl... 21 6.9 EF127806-1|ABL67943.1| 311|Tribolium castaneum nicotinic acetyl... 21 6.9 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 9.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 9.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.1 >U61151-1|AAB41306.1| 45|Tribolium castaneum TATH1 protein. Length = 45 Score = 21.8 bits (44), Expect = 3.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +3 Query: 402 AVQAKQTRRLDAIQDKLDRV 461 A A++ RR++++ D DR+ Sbjct: 1 AANARERRRMNSLNDAFDRL 20 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 190 SCYCFIGTVFLLFHRYYLTSRRFL 119 +C CF+ V L R S+RFL Sbjct: 202 NCICFVPGVLGLLSRSNKESQRFL 225 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 190 SCYCFIGTVFLLFHRYYLTSRRFL 119 +C CF+ V L R S+RFL Sbjct: 202 NCICFVPGVLGLLSRSNKESQRFL 225 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 190 SCYCFIGTVFLLFHRYYLTSRRFL 119 +C CF+ V L R S+RFL Sbjct: 202 NCICFVPGVLGLLSRSNKESQRFL 225 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 190 SCYCFIGTVFLLFHRYYLTSRRFL 119 +C CF+ V L R S+RFL Sbjct: 202 NCICFVPGVLGLLSRSNKESQRFL 225 >EF127809-1|ABL67946.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 311 Score = 21.0 bits (42), Expect = 6.9 Identities = 13/47 (27%), Positives = 20/47 (42%) Frame = +1 Query: 196 LNLRAWNIPIDRAMLSVAGACWRAFVWRAPHRPSLTIFVSTHQIRTA 336 LNL A IP + + G + ++ LT+ V + RTA Sbjct: 257 LNLVAEKIPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTA 303 >EF127806-1|ABL67943.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 311 Score = 21.0 bits (42), Expect = 6.9 Identities = 13/47 (27%), Positives = 20/47 (42%) Frame = +1 Query: 196 LNLRAWNIPIDRAMLSVAGACWRAFVWRAPHRPSLTIFVSTHQIRTA 336 LNL A IP + + G + ++ LT+ V + RTA Sbjct: 257 LNLVAEKIPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTA 303 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 20.6 bits (41), Expect = 9.1 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = -2 Query: 149 PVLFNFATVSEHVLRVGTRSRYTRATRCGCRSMPQRLCFECR 24 P+LF + ++ R GT R R R + L CR Sbjct: 231 PLLFTYTDDGKNQQRTGTELTKMRPKRQSSRRHRKNLKDPCR 272 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 526 SLCSKSSAASCTLSNFKDRVVSTRSN 449 ++C + S + NF D S RSN Sbjct: 402 NVCFRPRNNSILIKNFNDSPESNRSN 427 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 9.1 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -1 Query: 384 HATALQCWLEC 352 +A L CW EC Sbjct: 724 YAVMLNCWKEC 734 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,442 Number of Sequences: 336 Number of extensions: 2431 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -