BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0143 (612 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC227.02c |||rRNA processing protein Rrp15 |Schizosaccharomyce... 30 0.30 SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|c... 26 4.9 SPCC1682.16 |rpt4||19S proteasome regulatory subunit Rpt4|Schizo... 25 8.6 SPBC725.06c |ppk31|mug25|serine/threonine protein kinase Ppk31 |... 25 8.6 >SPAC227.02c |||rRNA processing protein Rrp15 |Schizosaccharomyces pombe|chr 1|||Manual Length = 205 Score = 29.9 bits (64), Expect = 0.30 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = +2 Query: 44 ANAKSEKPASSEDKDTPIRQIMTIIEHKIR--NLEKRKSKLTSYRDLQKAGKELNSDQKV 217 A+ +++ ++++DTP+ + + +R N EK+ SKL + R ++ KE+ Sbjct: 72 ADILNQQVTQTDEQDTPVLSLSKKSKKALRKSNAEKKDSKLRTSRRRERLRKEMVGRVTS 131 Query: 218 AVAKYDEVAQTL 253 VA E A+ L Sbjct: 132 VVAVNAETAKAL 143 >SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 25.8 bits (54), Expect = 4.9 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = +2 Query: 65 PASSEDKDTPI--RQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKVAVAKYDE 238 P ED P Q I +K+K+ +LQ AGK+L + Q+ A Y + Sbjct: 134 PTDQEDPRNPQLDSQYEAFITQGESQTDKKKTSTVQEEELQNAGKKLETVQENPQA-YSK 192 Query: 239 VAQ 247 V Q Sbjct: 193 VTQ 195 >SPCC1682.16 |rpt4||19S proteasome regulatory subunit Rpt4|Schizosaccharomyces pombe|chr 3|||Manual Length = 388 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 137 LEKRKSKLTSYRDLQKAGKELNSDQKVAVAKYDE 238 LEK KS L +R+ K+L + V KYD+ Sbjct: 8 LEKYKSYLLQHREWDSKLKDLRFGNRDLVKKYDK 41 >SPBC725.06c |ppk31|mug25|serine/threonine protein kinase Ppk31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1032 Score = 25.0 bits (52), Expect = 8.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 317 KNKLKRKPGFVMQQRPTK*KKFYLF 391 KN+ + K F +Q+RP K +++LF Sbjct: 1008 KNQQRNKEKFRIQKRPNKKYRYHLF 1032 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,321,484 Number of Sequences: 5004 Number of extensions: 41179 Number of successful extensions: 119 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -