BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0143 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 32 0.32 SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) 31 0.97 SB_22971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7678| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_933| Best HMM Match : ExoD (HMM E-Value=6) 29 3.0 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 3.0 SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) 29 3.9 SB_41836| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.5e-07) 28 5.2 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 27 9.1 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 64.5 bits (150), Expect = 6e-11 Identities = 32/75 (42%), Positives = 46/75 (61%) Frame = +2 Query: 32 MPSAANAKSEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQ 211 MPSA++ S+ A + D + + ++E K+RNLEKRK KL Y+ +G+ELN+DQ Sbjct: 1 MPSASSKPSDSQALMDSSDIA-KSGLLLVEKKVRNLEKRKLKLDGYKKQMDSGQELNADQ 59 Query: 212 KVAVAKYDEVAQTLD 256 K A+A D V LD Sbjct: 60 KAAIANLDVVEMNLD 74 Score = 47.6 bits (108), Expect = 8e-06 Identities = 25/53 (47%), Positives = 33/53 (62%) Frame = +1 Query: 346 RYAAETNKIKEVLLILDCLMQMGSADARTDFINGTNGAAKLTEDXLKILDDLY 504 ++ A+ K+ EVL L LM S D RTDF+NGTNGA +TED +D+ Y Sbjct: 109 QHNADVLKVNEVLE-LQHLMDSLSEDVRTDFLNGTNGAVVVTEDQFVQIDEFY 160 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +2 Query: 83 KDTPIRQIMTIIEHKIRNLEKRKSKLTSY-RDLQKAGKELNSDQKVAVAK 229 KD+ ++ ++ E KIR L+KR S+L S R L+ K+L D+K A+ K Sbjct: 322 KDSGNQKATSLGEEKIRKLKKRNSELVSIARQLEDKAKKL-QDEKNAILK 370 >SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) Length = 3368 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/55 (23%), Positives = 30/55 (54%) Frame = +2 Query: 56 SEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKVA 220 +E+P + + T++++ + + ++ T +RD+Q+ GKE NSD ++ Sbjct: 1928 TEQPVAPSASLQTTKAEKTLVKNTAESTKYTETSSTQHRDIQQRGKEQNSDDALS 1982 >SB_22971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 119 EHKIRNLEKRKSKLTSYRDLQKAGKELNSDQ 211 + KIRNL+K+ ++ + QKAGK+L +Q Sbjct: 65 DKKIRNLKKKLRQIEELKTQQKAGKQLEVNQ 95 >SB_7678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1432 Score = 29.9 bits (64), Expect = 1.7 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +2 Query: 8 KKSCCL*RMPSAANAKSEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKA 187 KK L ++PS N K + KD+ IR ++T I E+++ +D Q Sbjct: 1136 KKDRTLRKLPSKENMSDGKDNLEDGKDSSIRGVLTDYNISIPAQERKRKLGRPRKDEQNL 1195 Query: 188 G-KELNSDQKVA 220 G K+ N + + A Sbjct: 1196 GSKKKNGESQTA 1207 >SB_933| Best HMM Match : ExoD (HMM E-Value=6) Length = 555 Score = 29.1 bits (62), Expect = 3.0 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = -2 Query: 503 YKSSKIFKXSSVNLAAPFVPFMKSVLASALPICIRQSRISKTSFILLVSA 354 Y SS S++N++ PF+P+ V+ P +RQ I K FI LVSA Sbjct: 82 YPSSMDGVDSTLNMS-PFIPY---VIRPKGPRLLRQGTIMKAGFIGLVSA 127 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 29.1 bits (62), Expect = 3.0 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +2 Query: 56 SEKPASSEDKDTPIRQIMTIIEHKIRNLEK-RKSKLTSYRDLQKAGKELNSDQKVAVAKY 232 SE A ++KD + + + + KI+ + +KSK +L KAGK + + V K Sbjct: 861 SESEAEDDEKD--VEEKHEVKQDKIKKKKHDKKSKAKDKDNLAKAGKAIQAILDVTTRKK 918 Query: 233 DEVAQTL 253 + AQ+L Sbjct: 919 ADAAQSL 925 >SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) Length = 2110 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +2 Query: 77 EDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKVAVAK--YDEVAQT 250 E +D PI +I ++++ N+EK K ++D ++ GK +K K D+ QT Sbjct: 208 EIEDEPINEISSLVDFVDENIEKSLLKDPLWQDEEEKGKRKKKKKKRKRDKSLQDQTCQT 267 Query: 251 L 253 + Sbjct: 268 M 268 >SB_41836| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.5e-07) Length = 1128 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 77 EDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRD 175 ED++ IRQ+ IIE K ++E++ +L RD Sbjct: 847 EDREDEIRQLRQIIEDKESDIEEQVMELIHLRD 879 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 27.5 bits (58), Expect = 9.1 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +2 Query: 56 SEKPASSEDKDTPIRQIMTIIEHKIRNLEKR--KSKLTSYRDLQKAGKELNSDQKVAVAK 229 SE S +D+ + + +E ++ L SKL + DL A +L ++ V + Sbjct: 587 SENSQSMQDRILKLEEERNSLEVEVSRLRSELVSSKLKADEDLMNAKTKLKQEELVRSRQ 646 Query: 230 YDE 238 YDE Sbjct: 647 YDE 649 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = -2 Query: 560 GENQIGPSAI*FMLRGHPGYKSSKIFKXSSVNLAAPFVPFMKSVLASALPICIR 399 G Q G + RG+PGY ++ + P S L+ PICI+ Sbjct: 392 GYQQPGYPQSPYQQRGYPGYPQVSPYQQQGAPMTGNGGPCSPSCLSHCTPICIQ 445 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,938,117 Number of Sequences: 59808 Number of extensions: 290006 Number of successful extensions: 667 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -