BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0143 (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 30 0.068 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 7.8 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 29.9 bits (64), Expect = 0.068 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +2 Query: 53 KSEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKVAVAK- 229 + E+ A+ +D+ +R + EH+IRN E +K S D +A E + VA+ + Sbjct: 324 QEEQLAAVDDELKKLRTSIEEQEHRIRNREALVAKTDSTIDTYRADIESKKQEYVALKEA 383 Query: 230 YDEVAQTL 253 Y V +TL Sbjct: 384 YGTVRRTL 391 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 544 PIWFSPSNNQSCRNHL 591 P+W + NQ CR L Sbjct: 813 PVWHEATKNQECRRML 828 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 575,230 Number of Sequences: 2352 Number of extensions: 9190 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -