BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0140 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 3.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 3.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 3.3 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 5.7 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 3.3 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -2 Query: 185 GASVVPDVY-SMYKGSL---ASTDSHGTGSASKPSSQDMSLP 72 G ++ D Y SM G+ AS H TGSA P++ LP Sbjct: 232 GQHLLQDTYKSMLPGAQTVGASFGLHATGSAPSPTAGAGGLP 273 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 143 NPCTYYTHLVQLTPQKE 193 NP Y+ L+ + P+KE Sbjct: 323 NPADYFIQLLAIVPEKE 339 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 143 NPCTYYTHLVQLTPQKE 193 NP Y+ L+ + P+KE Sbjct: 323 NPADYFIQLLAIVPEKE 339 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 276 ASDLGWVVGHSYICYGPLLAG 338 A D W V + I Y PLLAG Sbjct: 414 AEDSKWRVRSAIIEYMPLLAG 434 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,255 Number of Sequences: 336 Number of extensions: 4739 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -