BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0139 (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 2.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.5 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 681 LNFKKNWNFYPSK*CLVF 628 +N+ + W F PSK LVF Sbjct: 287 VNWGEQWGFLPSKDSLVF 304 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 9.5 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 402 GARACPMLDTKAGSPTCCKVGAGGFPAWAAQPKNASXFXAN 524 G P L TK G+P V +G F + P N + F N Sbjct: 832 GKATSPNL-TKWGNPNRPIVQSGIFGKYMVSPSNDALFVLN 871 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,088 Number of Sequences: 438 Number of extensions: 4162 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -