BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0137 (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 23 2.3 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.1 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 5.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 7.1 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.4 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 518 SLRAEMEKFYNESWGGENFNHS 583 +L + + FY E W G++F+ S Sbjct: 218 ALPKQEDCFYQEGWNGQSFDVS 239 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 352 TLAITMFSQMAFATGTFLSFIV 287 TLA T +S + F T FL FI+ Sbjct: 227 TLANTFWSALYFLTIIFLFFII 248 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 40 NKSKTSYVVTEKSLPNADVYESDSSHSENVKEKPAK 147 N KT Y + KSLP +S H+++ ++ K Sbjct: 186 NTGKTQYNLNSKSLPR-QYSQSRGRHNQSRSKRQPK 220 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 637 FGSIAHKLLSRDIFFWISRMIEVLSAPAFI 548 FG+IAH L S ++ ++ E LS A + Sbjct: 1350 FGTIAHILASTELNLCCTKKKEELSPNALL 1379 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 637 FGSIAHKLLSRDIFFWISRMIEVLSAPAFI 548 FG+IAH L S ++ ++ E LS A + Sbjct: 1350 FGTIAHILASTELNLCCTKKKEELSPNALL 1379 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 637 FGSIAHKLLSRDIFFWISRMIEVLSAPAFI 548 FG+IAH L S ++ ++ E LS A + Sbjct: 1350 FGTIAHILASTELNLCCTKKKEELSPNALL 1379 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 637 FGSIAHKLLSRDIFFWISRMIEVLSAPAFI 548 FG+IAH L S ++ ++ E LS A + Sbjct: 1350 FGTIAHILASTELNLCCTKKKEELSPNALL 1379 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 218 MFSVSSKGFSREVLLSEL 165 +FSVSS ++ EVL S L Sbjct: 229 LFSVSSSSYNCEVLFSFL 246 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/28 (25%), Positives = 18/28 (64%) Frame = -3 Query: 481 LPFKLSKSRSSFRIGGTLVETYMDMSLL 398 +P K +++ +RIG ++ Y+D +++ Sbjct: 774 IPNKYYEAKQVYRIGSNGLQCYIDRNVV 801 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,120 Number of Sequences: 336 Number of extensions: 3414 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -