BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0137 (684 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1039 - 34011133-34012218 29 3.4 >01_06_1039 - 34011133-34012218 Length = 361 Score = 29.1 bits (62), Expect = 3.4 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 2/129 (1%) Frame = -2 Query: 407 VLVGYMHISIVIRDTKARDIGHNYVLTDGICNWHIFIIYSQINDIYLDYGLLISSVRLIS 228 VLV YM++++ I + + + Y+L + NW I + ++ + L I+ VRL+ Sbjct: 25 VLVSYMYVAVWIFLSFTVIVYNKYILDPKMYNWPFPISLTMVHMAFCS-SLAIALVRLLR 83 Query: 227 VTSMFSVSSKGFSREVLLSELSKSVFIFA-GFSFTFSEWLE-SDS*TSALGKLFSVTTYE 54 V + SS + ++ S + +++ F+ S ++ S S L L V Y Sbjct: 84 VVEL--PSSPAMTPQLYTSSVLPIGALYSLSLWFSNSAYIYLSVSFIQMLKALMPVAVYS 141 Query: 53 VLLLFDSIN 27 + +LF N Sbjct: 142 IGVLFKKEN 150 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,965,059 Number of Sequences: 37544 Number of extensions: 333297 Number of successful extensions: 690 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -