BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0129 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g04170.1 68418.m00405 calcium-binding EF hand family protein ... 40 0.001 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 40 0.001 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 40 0.001 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 40 0.001 At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmod... 35 0.045 At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calm... 34 0.079 At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to ca... 34 0.079 At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to... 34 0.079 At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost i... 34 0.079 At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identica... 34 0.079 At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identica... 34 0.079 At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identica... 34 0.079 At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calm... 34 0.079 At3g22930.1 68416.m02889 calmodulin, putative strong similarity ... 33 0.14 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 0.56 At5g54270.1 68418.m06760 chlorophyll A-B binding protein / LHCII... 31 0.73 At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to calmod... 31 0.73 At1g74740.1 68414.m08660 calcium-dependent protein kinase, putat... 31 0.73 At1g03960.2 68414.m00382 calcium-binding EF hand family protein ... 31 0.73 At1g03960.1 68414.m00381 calcium-binding EF hand family protein ... 31 0.73 At4g12860.1 68417.m02014 calcium-binding protein, putative simil... 31 0.97 At3g47480.1 68416.m05163 calcium-binding EF hand family protein ... 31 0.97 At2g27480.1 68415.m03321 calcium-binding EF hand family protein ... 30 1.3 At4g21940.1 68417.m03174 calcium-dependent protein kinase, putat... 29 2.2 At2g25970.1 68415.m03117 KH domain-containing protein 29 2.2 At5g12480.1 68418.m01466 calmodulin-domain protein kinase isofor... 29 3.0 At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat... 29 3.0 At1g76040.1 68414.m08830 calcium-dependent protein kinase, putat... 29 3.0 At3g20410.1 68416.m02585 calmodulin-domain protein kinase isofor... 29 3.9 At3g07490.1 68416.m00893 calcium-binding protein, putative simil... 29 3.9 At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein... 29 3.9 At5g19360.1 68418.m02307 calcium-dependent protein kinase, putat... 28 5.2 At3g53970.2 68416.m05962 proteasome inhibitor-related similar to... 28 5.2 At3g53970.1 68416.m05963 proteasome inhibitor-related similar to... 28 5.2 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-r... 28 5.2 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-r... 28 5.2 At1g50700.1 68414.m05701 calcium-dependent protein kinase, putat... 28 5.2 At1g79440.1 68414.m09258 succinate-semialdehyde dehydrogenase (S... 28 6.8 At1g18530.1 68414.m02312 calmodulin, putative similar to calmodu... 28 6.8 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 28 6.8 At5g12180.1 68418.m01429 calcium-dependent protein kinase, putat... 27 9.0 At4g35310.1 68417.m05019 calcium-dependent protein kinase, putat... 27 9.0 At3g10660.1 68416.m01282 calcium-dependent protein kinase isofor... 27 9.0 At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identica... 27 9.0 >At5g04170.1 68418.m00405 calcium-binding EF hand family protein low similarity to peflin [Homo sapiens] GI:6015440; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 354 Score = 40.3 bits (90), Expect = 0.001 Identities = 30/74 (40%), Positives = 39/74 (52%), Gaps = 3/74 (4%) Frame = +2 Query: 272 NSGYPGQAAYGGMPPGQLEIGHGPYPSI---GVGGTITPQVQQWFRAVDKDQSGFITSTE 442 +SG+ G YGG PP Q G P+ S+ G P + F+A D+D SGFI E Sbjct: 152 SSGHGG--GYGGYPP-QASYG-SPFASLIPSGFAPGTDPNIVACFQAADQDGSGFIDDKE 207 Query: 443 LRSALVNAQGQTFS 484 L+ AL + Q Q FS Sbjct: 208 LQGALSSYQ-QRFS 220 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 40.3 bits (90), Expect = 0.001 Identities = 30/76 (39%), Positives = 40/76 (52%), Gaps = 7/76 (9%) Frame = +2 Query: 278 GYPGQAAYGG---MPPGQLEIGHGPY----PSIGVGGTITPQVQQWFRAVDKDQSGFITS 436 G P Q+ +GG PP Q G P+ PS GT P + F+A D+D SGFI Sbjct: 129 GAPQQSGHGGGYGAPPPQASYG-SPFASLVPSAFPPGT-DPNIVACFQAADRDNSGFIDD 186 Query: 437 TELRSALVNAQGQTFS 484 EL+ AL ++ Q+FS Sbjct: 187 KELQGAL-SSYNQSFS 201 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +2 Query: 383 VQQW---FRAVDKDQSGFITSTELRSALVN 463 +Q W F DKD+SG I + ELR AL++ Sbjct: 232 LQNWRSIFERFDKDRSGRIDTNELRDALMS 261 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 40.3 bits (90), Expect = 0.001 Identities = 30/76 (39%), Positives = 40/76 (52%), Gaps = 7/76 (9%) Frame = +2 Query: 278 GYPGQAAYGG---MPPGQLEIGHGPY----PSIGVGGTITPQVQQWFRAVDKDQSGFITS 436 G P Q+ +GG PP Q G P+ PS GT P + F+A D+D SGFI Sbjct: 129 GAPQQSGHGGGYGAPPPQASYG-SPFASLVPSAFPPGT-DPNIVACFQAADRDNSGFIDD 186 Query: 437 TELRSALVNAQGQTFS 484 EL+ AL ++ Q+FS Sbjct: 187 KELQGAL-SSYNQSFS 201 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +2 Query: 383 VQQW---FRAVDKDQSGFITSTELRSALVN 463 +Q W F DKD+SG I + ELR AL++ Sbjct: 232 LQNWRSIFERFDKDRSGRIDTNELRDALMS 261 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 40.3 bits (90), Expect = 0.001 Identities = 30/76 (39%), Positives = 40/76 (52%), Gaps = 7/76 (9%) Frame = +2 Query: 278 GYPGQAAYGG---MPPGQLEIGHGPY----PSIGVGGTITPQVQQWFRAVDKDQSGFITS 436 G P Q+ +GG PP Q G P+ PS GT P + F+A D+D SGFI Sbjct: 129 GAPQQSGHGGGYGAPPPQASYG-SPFASLVPSAFPPGT-DPNIVACFQAADRDNSGFIDD 186 Query: 437 TELRSALVNAQGQTFS 484 EL+ AL ++ Q+FS Sbjct: 187 KELQGAL-SSYNQSFS 201 >At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmodulin-6 SP:Q03509 from [Arabidopsis thaliana]; contains Pfam profile: PF00036 EF hand Length = 149 Score = 35.1 bits (77), Expect = 0.045 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++++ FR DKDQ+GFI++ ELR + N G+ S+ + D D +G Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTNL-GEKLSDEEVDEMIREADVDGDG 135 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG 99 >At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calmodulin 4 [Arabidopsis thaliana] GI:16223, SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTN 112 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNG 99 >At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to calmodulin GI:474183 from [Arabidopsis thaliana]; almost identical to calmodulin-2/3/5 SP:P25069 [Arabidopsis thaliana] Length = 149 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTN 112 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG 99 >At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to calmodulin GI:16227 from [Arabidopsis thaliana], SP|P59220 Calmodulin-7 {Arabidopsis thaliana} Length = 149 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTN 112 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG 99 >At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost identical to Calmodulin-2/3/5 SP:P25069 from [Arabidopsis thaliana] Length = 149 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTN 112 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG 99 >At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 181 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTN 112 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG 99 >At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 113 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 49 ELKEAFRVFDKDQNGFISAAELRHVMTN 76 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 12 ELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG 63 >At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 149 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTN 112 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNG 99 >At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calmodulin [Arabidopsis thaliana] GI:16223; nearly identical to SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ FR DKDQ+GFI++ ELR + N Sbjct: 85 ELKEAFRVFDKDQNGFISAAELRHVMTN 112 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q VD D +G I E + + T SE +FDKD+NG Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNG 99 >At3g22930.1 68416.m02889 calmodulin, putative strong similarity to calmodulin 8 GI:5825600 from [Arabidopsis thaliana]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 173 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/28 (39%), Positives = 23/28 (82%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ F+ DKDQ+G+I+++ELR ++N Sbjct: 108 ELKEAFKVFDKDQNGYISASELRHVMIN 135 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q +D D +G I +E + + N +T ++ +FDKD+NG Sbjct: 71 ELQDMITEIDSDGNGTIEFSEFLNLMANQLQETDADEELKEAFKVFDKDQNG 122 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.5 bits (68), Expect = 0.56 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 278 GYPGQAAYGGMPPGQLEIGHGPYPSIG 358 GYP YGG PP GHG YP G Sbjct: 69 GYPPAPGYGGYPPAP---GHGGYPPAG 92 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 278 GYPGQAAYGGMPPGQLEIGHGPY-PSIGVGG 367 GYP YGG PP G+G Y P+ G GG Sbjct: 60 GYPPAPGYGGYPPAP---GYGGYPPAPGHGG 87 >At5g54270.1 68418.m06760 chlorophyll A-B binding protein / LHCII type III (LHCB3) identical to Lhcb3 protein [Arabidopsis thaliana] GI:4741952; contains Pfam profile PF00504: Chlorophyll A-B binding protein Length = 265 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 323 LEIGHGPYPSIGVGGTITPQV-QQWFRAVDKDQSGFITSTELRS 451 LE+ HG + +G G ITP+V Q+W R K+ F +++ S Sbjct: 95 LEVIHGRWAMLGAFGCITPEVLQKWVRVDFKEPVWFKAGSQIFS 138 >At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to calmodulin 8 GI:5825600 from [Arabidopsis thaliana] Length = 151 Score = 31.1 bits (67), Expect = 0.73 Identities = 10/28 (35%), Positives = 22/28 (78%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN 463 ++++ F+ DKDQ+G+I+++EL ++N Sbjct: 86 ELKEAFKVFDKDQNGYISASELSHVMIN 113 >At1g74740.1 68414.m08660 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 541 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 386 QQWFRAVDKDQSGFITSTELRSALVNAQGQ 475 +Q F DKD SG+I S ELR AL + G+ Sbjct: 438 RQAFMFFDKDGSGYIESEELREALTDELGE 467 >At1g03960.2 68414.m00382 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 389 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 377 PQVQQWFRAVDKDQSGFITSTELR 448 P ++ WF+ VD D +G ITS E++ Sbjct: 244 PSLEYWFKCVDLDGNGVITSNEMQ 267 >At1g03960.1 68414.m00381 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 529 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 377 PQVQQWFRAVDKDQSGFITSTELR 448 P ++ WF+ VD D +G ITS E++ Sbjct: 384 PSLEYWFKCVDLDGNGVITSNEMQ 407 >At4g12860.1 68417.m02014 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 152 Score = 30.7 bits (66), Expect = 0.97 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +2 Query: 383 VQQWFRAVDKDQSGFITSTELRSALVN---AQGQTFSETACNSDDGMFDKDRNG 535 +++ FR D++ GFIT ELRS L + QG+T + C D D +G Sbjct: 79 MREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLED--CKKMISKVDVDGDG 130 >At3g47480.1 68416.m05163 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 183 Score = 30.7 bits (66), Expect = 0.97 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 383 VQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 V++ FR D++Q GFI EL+ L ++ C ++D++R+G Sbjct: 117 VKEAFRLFDENQDGFIDENELKHVLSLLGYDECTKMECRKMVKVYDENRDG 167 >At2g27480.1 68415.m03321 calcium-binding EF hand family protein similar to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 186 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 377 PQVQQWFRAVDKDQSGFITSTELRSAL 457 P++ + F + D+++SGF+ +ELR AL Sbjct: 8 PEIVRSFESADRNRSGFLEESELRQAL 34 >At4g21940.1 68417.m03174 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423 Length = 554 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSAL 457 F+ DKD SGFIT EL SA+ Sbjct: 483 FQYFDKDNSGFITMDELESAM 503 >At2g25970.1 68415.m03117 KH domain-containing protein Length = 632 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 251 RALQMAYNSGYPGQAAYGGMPPGQLEIGHGPYPSIGVGGTITP 379 R A GYP Q Y PP GP G GG + P Sbjct: 306 RMRNSAMGGGYPQQGGYQARPPSSWAPPGGPPAQPGYGGYMQP 348 >At5g12480.1 68418.m01466 calmodulin-domain protein kinase isoform 7 (CPK7) identical to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 535 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 F D++QSG+I ELR AL + T SE + D D++G Sbjct: 441 FNFFDQNQSGYIEIDELREALNDELDNTSSEEVIAAIMQDVDTDKDG 487 >At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 534 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +2 Query: 383 VQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q F+ +D D+SG IT ELR+ L + G +E+ D D++G Sbjct: 390 LKQTFKNMDTDESGTITFDELRNGL-HRLGSKLTESEIKQLMEAADVDKSG 439 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSAL 457 F+ DKD+SGFIT EL+ ++ Sbjct: 466 FKYFDKDRSGFITRDELKHSM 486 >At1g76040.1 68414.m08830 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 323 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +2 Query: 383 VQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 ++Q F+ +D D+SG IT ELR+ L + G +E+ D D++G Sbjct: 179 LKQTFKNMDTDESGTITFDELRNGL-HRLGSKLTESEIKQLMEAADVDKSG 228 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSAL 457 F+ DKD+SGFIT EL+ ++ Sbjct: 255 FKYFDKDRSGFITRDELKHSM 275 >At3g20410.1 68416.m02585 calmodulin-domain protein kinase isoform 9 (CPK9) identical to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 541 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSAL 457 F+ DKD SG+IT EL SAL Sbjct: 473 FQHFDKDSSGYITIDELESAL 493 >At3g07490.1 68416.m00893 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 153 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +2 Query: 383 VQQWFRAVDKDQSGFITSTELRSALVN---AQGQTFSETACNSDDGMFDKDRNG 535 +++ F D+++ GFIT ELRS L + QG+T + C D D +G Sbjct: 79 MREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLED--CKRMISKVDVDGDG 130 >At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein, 22 kDa (CaBP-22) identical to SP|P30187 22 kDa calmodulin-like calcium-binding protein (CABP-22) [Arabidopsis thaliana] Length = 191 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +2 Query: 350 SIGVGGTITPQVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDR 529 S+G+ T ++Q+ D D G I TE A+ T+SE D +FD D+ Sbjct: 39 SLGLNLT-QAELQEEINDSDLDGDGTINFTEFLCAMAK---DTYSEKDLKKDFRLFDIDK 94 Query: 530 NG 535 NG Sbjct: 95 NG 96 >At5g19360.1 68418.m02307 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748 Length = 523 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSAL 457 F+ DKD SG+IT+ EL AL Sbjct: 450 FQHFDKDNSGYITTEELEQAL 470 >At3g53970.2 68416.m05962 proteasome inhibitor-related similar to proteasome inhibitor PI31 subunit (hPI31) SP:Q92530 from [Homo sapiens] Length = 252 Score = 28.3 bits (60), Expect = 5.2 Identities = 23/79 (29%), Positives = 33/79 (41%) Frame = +2 Query: 296 AYGGMPPGQLEIGHGPYPSIGVGGTITPQVQQWFRAVDKDQSGFITSTELRSALVNAQGQ 475 A GG P LEI G Y G + Q + + V QS I + + V ++ Q Sbjct: 104 ADGGAEPAHLEIKVGDYAEESNEGDYSAQFKNLDKLVTDLQSEIIDKLDGKPKPVASRAQ 163 Query: 476 TFSETACNSDDGMFDKDRN 532 + SET N + +D N Sbjct: 164 SSSET--NEEPRYYDDTPN 180 >At3g53970.1 68416.m05963 proteasome inhibitor-related similar to proteasome inhibitor PI31 subunit (hPI31) SP:Q92530 from [Homo sapiens] Length = 302 Score = 28.3 bits (60), Expect = 5.2 Identities = 23/79 (29%), Positives = 33/79 (41%) Frame = +2 Query: 296 AYGGMPPGQLEIGHGPYPSIGVGGTITPQVQQWFRAVDKDQSGFITSTELRSALVNAQGQ 475 A GG P LEI G Y G + Q + + V QS I + + V ++ Q Sbjct: 104 ADGGAEPAHLEIKVGDYAEESNEGDYSAQFKNLDKLVTDLQSEIIDKLDGKPKPVASRAQ 163 Query: 476 TFSETACNSDDGMFDKDRN 532 + SET N + +D N Sbjct: 164 SSSET--NEEPRYYDDTPN 180 >At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 235 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 + ++ FR DK+ G+IT ELR+ + + G+T +T D + + D +G Sbjct: 102 EFREAFRVFDKNGDGYITVNELRTTM-RSLGET--QTKAELQDMINEADADG 150 >At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 324 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVNAQGQTFSETACNSDDGMFDKDRNG 535 + ++ FR DK+ G+IT ELR+ + + G+T +T D + + D +G Sbjct: 191 EFREAFRVFDKNGDGYITVNELRTTM-RSLGET--QTKAELQDMINEADADG 239 >At1g50700.1 68414.m05701 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 521 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 383 VQQWFRAVDKDQSGFITSTELRSAL 457 V + F+ DKD SG+IT+ EL +AL Sbjct: 451 VYKAFQHFDKDGSGYITTDELEAAL 475 >At1g79440.1 68414.m09258 succinate-semialdehyde dehydrogenase (SSADH1) similar to succinate-semialdehyde dehydrogenase [NADP+] (SSDH) [Escherichia coli] SWISS-PROT:P25526; identical to succinic semialdehyde dehydrogenase mRNA, nuclear gene encoding mitochondrial protein GI:6684441; contains TIGRfam profile TIGR01780:succinic semialdehyde dehydrogenase; contains Pfam profile PF00171: aldehyde dehydrogenase (NAD) family protein Length = 528 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 293 AAYGGMPPGQLEIGHGPYPSIGVGGTITPQVQQ 391 A G+PPG L + G P IG +PQV++ Sbjct: 238 ALQAGVPPGALNVVMGNAPEIGDALLTSPQVRK 270 >At1g18530.1 68414.m02312 calmodulin, putative similar to calmodulin GI:1565285 from [Toxoplasma gondii] Length = 157 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 380 QVQQWFRAVDKDQSGFITSTELRSALVN-AQGQTFSE 487 Q+ + F++ D+D +GFI++ EL A+ Q T+ E Sbjct: 82 QLLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKE 118 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 266 AYNSGYPGQAAYGGMPPGQLEIGHGPYPSIGVGG 367 +++ GYP YGG PP G Y GG Sbjct: 39 SHHEGYPPPQPYGGYPPPSSRPYEGGYQGYFAGG 72 >At5g12180.1 68418.m01429 calcium-dependent protein kinase, putative / CDPK, putative Length = 528 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSAL 457 F+ DKD SG+IT EL AL Sbjct: 455 FQHFDKDNSGYITMEELEQAL 475 >At4g35310.1 68417.m05019 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 556 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSALV 460 F+ DKD SGFIT EL+ A V Sbjct: 479 FQYFDKDGSGFITIDELQQACV 500 >At3g10660.1 68416.m01282 calcium-dependent protein kinase isoform 2 (CPK2) identical to calcium-dependent protein kinase isoform 2 [Arabidopsis thaliana] gi|9837343|gb|AAG00535; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 646 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 395 FRAVDKDQSGFITSTELRSA 454 F DKD+SGFIT EL+ A Sbjct: 568 FSYFDKDESGFITPDELQQA 587 >At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identical to calmodulin-like MSS3 from GI:9965747 [Arabidopsis thaliana] Length = 215 Score = 27.5 bits (58), Expect = 9.0 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +2 Query: 362 GGTITPQVQQWFRAVDKDQSGFITSTELRSALVN---AQGQTFSETACNSDDGMFDKDRN 532 G T ++ F D+D GFIT EL+S + + QG+T C D D + Sbjct: 137 GETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLD--GCKKMIMQVDADGD 194 Query: 533 G 535 G Sbjct: 195 G 195 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,408,019 Number of Sequences: 28952 Number of extensions: 328153 Number of successful extensions: 883 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -