BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0127 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0509 - 4029739-4029890,4031064-4031208,4031665-4031709,403... 48 5e-06 04_03_0112 - 11369013-11369193,11369194-11369354,11370281-113703... 29 2.7 09_04_0744 - 19867604-19867686,19868075-19869872,19870777-198708... 29 4.7 11_06_0410 - 23223701-23223714,23223863-23225159,23225314-232262... 28 6.2 02_05_0090 - 25742533-25744557 28 6.2 >12_01_0509 - 4029739-4029890,4031064-4031208,4031665-4031709, 4031800-4031899,4032013-4032140,4032548-4032712, 4033033-4033162,4033252-4033412,4034306-4034351, 4034429-4034494,4034579-4034664,4035811-4035849 Length = 420 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/62 (40%), Positives = 37/62 (59%) Frame = +2 Query: 308 DSNDKLNQKCVLLAQLVKDSKHIVVHTGAGISTSAGIPDFRGPNGVWTLEKEGKKPTINV 487 DS+ + LL + + SK ++V TGAG+ST +GIPD+R PNG ++ G KP + Sbjct: 23 DSDPPSAKDVDLLYRFIDQSKKLMVLTGAGMSTESGIPDYRSPNGAYS---SGFKPLTHQ 79 Query: 488 SF 493 F Sbjct: 80 EF 81 >04_03_0112 - 11369013-11369193,11369194-11369354,11370281-11370383, 11370467-11370534,11372340-11372393,11374173-11374251, 11376054-11376133,11376584-11376692,11376813-11376913, 11378407-11378526,11379613-11379642,11380591-11380689 Length = 394 Score = 29.5 bits (63), Expect = 2.7 Identities = 23/70 (32%), Positives = 36/70 (51%) Frame = +2 Query: 260 LSPYENKGILGVPEKFDSNDKLNQKCVLLAQLVKDSKHIVVHTGAGISTSAGIPDFRGPN 439 LS E+ G +G+PE FDS + L++K LA +V++ V GA + +P Sbjct: 9 LSYREDVGNVGMPEIFDSPELLHKKIEELAVMVRERSGKGV-PGASLPFHRAVPTLT-HM 66 Query: 440 GVWTLEKEGK 469 + LEK G+ Sbjct: 67 ALVELEKTGR 76 >09_04_0744 - 19867604-19867686,19868075-19869872,19870777-19870801, 19872313-19872710 Length = 767 Score = 28.7 bits (61), Expect = 4.7 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = +2 Query: 251 CKGLSPYENKGILGVPEKFDSNDKLNQKCVLLAQLVKDSKHIVVHTGAGISTSAGIPDFR 430 CKGL ++ G+ GVP + N+ L +KC L++ ++ T +S + P F Sbjct: 688 CKGLLDSKD-GLSGVPHLTNLNELLVKKCGEKENLME-----ILQTQ--VSEHSKRPKFL 739 Query: 431 GPNGVWTLEKEGKKPTI 481 VW + +E K PT+ Sbjct: 740 IEYFVWLVTEESKYPTV 756 >11_06_0410 - 23223701-23223714,23223863-23225159,23225314-23226225, 23226952-23227023,23227323-23227471,23227879-23227912 Length = 825 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = -3 Query: 296 GLLVYLCFHKVIVLCIIARHFWETIYLMVLTQIFIEPLFKFKLRIFFYNMDTEESF*LWK 117 GLLV CF+K++V I ++ W +L + K N +T E + K Sbjct: 238 GLLVLQCFYKILVRHIASKSLWNGRSSELLQEYMGANGNKSNFNPEICNPETMEGY---K 294 Query: 116 YLISYTLRKNER 81 YL+ L+K+ + Sbjct: 295 YLVYGELQKSRK 306 >02_05_0090 - 25742533-25744557 Length = 674 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +2 Query: 341 LLAQLVKDSKHIVVHTGAGISTSAGIPDFRGPNGVWTLEKEGKKPTINVSFADAQP 508 LL+ V S I G S+S G+ R W+ + +G P++NVS A P Sbjct: 234 LLSAAVNLSAVIEDEAYVGFSSSTGVVASRHYVLAWSFKMDGPAPSLNVSKLPALP 289 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,397,773 Number of Sequences: 37544 Number of extensions: 379905 Number of successful extensions: 805 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -