BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0121 (599 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01420.1 68416.m00065 pathogen-responsive alpha-dioxygenase, ... 29 1.8 At4g14746.1 68417.m02269 expressed protein 27 9.5 At3g13290.1 68416.m01673 transducin family protein / WD-40 repea... 27 9.5 >At3g01420.1 68416.m00065 pathogen-responsive alpha-dioxygenase, putative similar to pathogen-inducible alpha-dioxygenase [Nicotiana attenuata] GI:12539609; contains Pfam profile PF03098: Animal haem peroxidase Length = 639 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -3 Query: 270 VTDGATEDLALFCMKSLSDSLPGSVMSMTSYFIFFESKIIRTRC*RFFTS 121 V DG E+L L + G +S T+++IF R RFFTS Sbjct: 526 VYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFLIMATRRLEADRFFTS 575 >At4g14746.1 68417.m02269 expressed protein Length = 250 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 572 FFNRTSLLYFFRCFNG 525 FF+R SL+ FF CF+G Sbjct: 97 FFDRKSLISFFLCFSG 112 >At3g13290.1 68416.m01673 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1322 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/70 (22%), Positives = 39/70 (55%) Frame = +2 Query: 56 ILKNTLSNMVVKIYISGISGNKEVKKRQQRVLMILDSKNIKYEVIDITEPGRESDKDFMQ 235 +++ T+S+ + + + GI G+K V + ++ V L++ + GR+ ++ ++ Sbjct: 1038 VIEKTVSSAITESFQRGI-GDKAVNQLEKSVNSKLETTVARQIQAQFQTSGRQVLQEGLR 1096 Query: 236 NNAKSSVAPS 265 ++ +SSV PS Sbjct: 1097 SSMESSVIPS 1106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,746,001 Number of Sequences: 28952 Number of extensions: 172672 Number of successful extensions: 471 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -