BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0117 (691 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 27 0.42 DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary ... 25 3.0 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 9.1 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 9.1 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 23 9.1 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 9.1 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 9.1 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 9.1 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 9.1 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 9.1 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 9.1 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 9.1 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 9.1 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 9.1 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 9.1 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 9.1 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 9.1 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 9.1 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 23 9.1 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 23 9.1 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 23 9.1 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 23 9.1 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 23 9.1 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 23 9.1 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal ... 23 9.1 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 27.5 bits (58), Expect = 0.42 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 550 RTNQSRLVLSQEGHFYSHHIMLWHTFCNAHNEGH 449 RTN + +++ GH SHH H N H GH Sbjct: 213 RTNNNNTIITDSGHMRSHH---QHYTAN-HQNGH 242 >DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 99 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -1 Query: 472 CNAHNEGHFSLNSF*NGCCSSRGRYINNRGSCSCACLC 359 C NE ++S S C++ + ++ G C C C Sbjct: 25 CTVENEEYYSCASPCRRNCTNLAQMLSCTGVCVSGCFC 62 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 128 GKKNIYLANNKITMLRDLDEGCRSR 152 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 143 GKKNIYLANNKITMLRDLDEGCRSR 167 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 68 GKKNIYLANNKITMLRDLDEGCRSR 92 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 68 GKKNIYLANNKITMLRDLDEGCRSR 92 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 68 GKKNIYLANNKITMLRDLDEGCRSR 92 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 68 GKKNIYLANNKITMLRDLDEGCRSR 92 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 68 GKKNIYLANNKITMLRDLDEGCRSR 92 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 234 GKQGTFHANKPLTMVLKLLEECHQR 308 GK+ + AN +TM+ L E C R Sbjct: 68 GKKNIYLANNKITMLRDLDEGCRSR 92 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 375 PVPAFASLTVPNTGLPRCSVPAFFGDT 295 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 375 PVPAFASLTVPNTGLPRCSVPAFFGDT 295 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 375 PVPAFASLTVPNTGLPRCSVPAFFGDT 295 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 375 PVPAFASLTVPNTGLPRCSVPAFFGDT 295 P P +LT N G P C+ F DT Sbjct: 139 PPPCPPTLTTFNGGQPTCAGKLLFEDT 165 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 375 PVPAFASLTVPNTGLPRCSVPAFFGDT 295 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 >AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal carrier protein A5 protein. Length = 211 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 647 TPIQLRCXPRLCTAAGHDTNFTLLGSNDTRNS*DQP 540 TP Q++ P+LC +TLL ++ S P Sbjct: 68 TPTQVKARPKLCWEVEPSALYTLLMADPDAPSRSNP 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 741,981 Number of Sequences: 2352 Number of extensions: 14794 Number of successful extensions: 67 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -