BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0115 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 25 0.69 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 8.5 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 8.5 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 8.5 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 25.0 bits (52), Expect = 0.69 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -1 Query: 615 VKQSQQQVGSLMNSENVQAREWYLHLLWLVLE 520 +K +Q+ GS + ++ + ++YL + W +LE Sbjct: 188 LKHMKQEAGSNLVAKGIDLSDFYLSVEWDILE 219 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 625 QKGYWRNGNVTLSFDLRRRXLSNV 696 Q +W GN LS D +S+V Sbjct: 19 QAQHWSRGNTWLSLDNSNMSMSSV 42 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 625 QKGYWRNGNVTLSFDLRRRXLSNV 696 Q +W GN LS D +S+V Sbjct: 19 QAQHWSRGNTWLSLDNSNMSMSSV 42 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 68 PFCIFNQSCYLFLKQ 24 P+C N SCY LK+ Sbjct: 9 PYCRRNFSCYYSLKR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,988 Number of Sequences: 438 Number of extensions: 4663 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -