BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0103 (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 26 1.3 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 25 2.3 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 2.3 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 3.0 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.0 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 9.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.2 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 403 SWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 287 ++V+AN L V FLL K L + W+ + S+DE Sbjct: 927 AFVMANALFVLVIFLLQLKKQELHIEWWFNVKNKISFDE 965 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 92 SFELPESNIDCDTXSRSAFSLSNT 21 +F LP+SN +C T +R S NT Sbjct: 142 NFHLPKSNRNCRTAARRNHSSRNT 165 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 502 RKES*RKMPH*SSRWPSCHLP 564 R+ R+ P RWPSC P Sbjct: 254 RRNPRRRSPRSGGRWPSCRSP 274 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 349 GNQEGSILIHQEDWLQPSCCRFRAHFWMARRQHVGAFNQN 468 G Q + I + WLQ + RA RR+H +F+ N Sbjct: 982 GRQFSNEGISGQSWLQLQQQKLRARREQQRREHSNSFSYN 1021 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 323 PPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 415 PP+S +KK+ Y+++ N +A F Sbjct: 333 PPWSNRTLRNLKKDRMKYLRRYRLNRSAFNF 363 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 9.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 78 WKFETSKYYVTIIDAPG 128 W +E K+ T+I+ PG Sbjct: 487 WNYEDYKFRTTVINMPG 503 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 303 TKWIPLNHHTVSPDLRKSRRK----YPHTSRRLATTQLLSLS 416 T ++ L+HH + PD+ K+ + + T AT +L+++S Sbjct: 822 TLFMALDHHDMDPDMEKALKSGNYFFTATFAIEATMKLIAMS 863 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 801,003 Number of Sequences: 2352 Number of extensions: 16956 Number of successful extensions: 36 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -