BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0101 (685 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_04_0143 + 16689471-16689498,16689687-16689818,16689974-166900... 28 6.0 06_03_0547 + 22001831-22002304 28 7.9 >01_04_0143 + 16689471-16689498,16689687-16689818,16689974-16690013, 16690214-16690280,16690349-16690431,16690755-16690821, 16692741-16692821,16693696-16693791,16694172-16694198 Length = 206 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +1 Query: 148 CYFFENSPLNKSHQI*RCMLS-SLPVWLWVC 237 CY E + L++ HQI C ++ S V +W C Sbjct: 71 CYHLEEADLHQCHQILTCTINGSSLVMIWCC 101 >06_03_0547 + 22001831-22002304 Length = 157 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 433 DEQGRIREVFRKLSDDSWEKTIGLISTSLRGVGRWTSRVTPH*KG 567 D +G I R L D++ ++ GL + VGRW SR +P +G Sbjct: 87 DGEGWIPTCLRSLDDEA-DRVGGLAAGDDPPVGRWKSRRSPRRRG 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,600,295 Number of Sequences: 37544 Number of extensions: 361265 Number of successful extensions: 916 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -